KEGG   Acidovorax ebreus: Dtpsy_1324
Entry
Dtpsy_1324        CDS       T00853                                 
Name
(GenBank) P-type conjugative transfer protein TrbG
  KO
K20532  type IV secretion system protein TrbG
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_1324
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_1324
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_1324
SSDB
Motif
Pfam: CagX
Other DBs
NCBI-ProteinID: ACM32789
Position
1383948..1384937
AA seq 329 aa
MNLSFRFYAFVLTLAALSGCASQGKPPPRISLDEPVLAQPLPEPPKPVEVVEVPKVLPMP
AQMKPLPDVDEDKPTPEPVDETVRVSRANAEARIAPTREGYVNAIQVWPFTDGALYQVYA
APGRVTVVSLQPGEELVTVAAGDTVRWIVGDTSSGAGAELRFNVLVKPTRSGLKTNLVVT
TNRRTYLLELTSTEKAWMASVSWDYPKDRMLALQRQSQTAQATAPVDTGLSLEKIRFRYA
VSGSNPPWKPLRAFDDGEKVYIQFPGGIAQGELPPLFVIGAQGDGQLVNYRFRSPYYIVD
RLFGAAELRLGGDKGDVVRIERTDGTRGK
NT seq 990 nt   +upstreamnt  +downstreamnt
atgaacctgtctttccgcttttacgcttttgtgctgaccttggcggccctgtcgggctgc
gcctcgcagggcaagccaccgccacgcatctcgctcgatgagccggtgctggcgcagccg
ttgcccgaaccaccgaagccggtggaagtggtggaggtgccgaaggtgctgccgatgccg
gcgcagatgaagccgctgcctgacgtggacgaagacaagcccacgccagagcctgtcgac
gaaaccgtgcgcgtctcgcgtgccaacgccgaggcgcgcatcgcgccgactcgcgagggc
tatgtcaacgcgattcaggtgtggcctttcactgatggcgcgctgtatcaggtctacgcc
gcgccggggcgcgtcaccgtcgtgtccctacagccgggcgaggaactggtgacggtcgcc
gccggcgacacggtgcgctggattgttggcgatacgtccagcggcgccggcgccgagctg
cgcttcaacgtgctggtgaagcccacccggtcgggcctcaagaccaatctagtcgtcacc
acgaaccgcaggacatacctgctggaactgacctcgacggaaaaagcgtggatggcatcg
gtgtcttgggactatccgaaagaccggatgttggccttgcagcgccagtcgcagaccgcg
caggcgaccgcgccggtcgatacgggcttgtcgctggagaagattcgcttccgctatgcg
gtcagcggcagcaatccaccgtggaagccattgcgcgctttcgacgacggcgagaaggtc
tatatccagttcccgggaggcatcgcgcagggcgagttgcctcccttgttcgtgatcggc
gcgcagggcgacgggcaactggtgaactaccgcttccgctcaccgtactacatcgtggat
cggctgttcggcgcggccgaacttcgcctgggcggggacaagggcgacgtggtgcgcatc
gagcgcacggatggcacgcgggggaaatga

DBGET integrated database retrieval system