KEGG   Acidovorax ebreus: Dtpsy_1624Help
Entry
Dtpsy_1624        CDS       T00853                                 

Definition
(GenBank) D-serine ammonia-lyase
  KO
K01753  D-serine dehydratase [EC:4.3.1.18]
Organism
dia  Acidovorax ebreus
Pathway
dia00260  Glycine, serine and threonine metabolism
dia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtpsy_1624
Enzymes [BR:dia01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.18  D-serine ammonia-lyase
     Dtpsy_1624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACM33083
UniProt: B9MIR7
Position
1713173..1714528
Genome map
AA seq 451 aa AA seqDB search
MPSVVSPQDRLQDDAPAAQLRRAEPCLWLNPHRQPIPAARQAVAGDHISLDDTKEAAARF
ARFAPLLEGVFPELQATGGVIESPLLPASSLHAAAGLVAGQGALWIKADHRLPVAGSIKA
RGGIHEVLELAERLALQHGLLTPQSDADDYRALANPAARAVFARYTVAVGSTGNLGLSIG
VAASALGFHAVVHMSADAKEWKKQRLRQRGVQVVEHAGDYEGAVAAGRAQAAQDPFSHFV
DDERSLSLLLGYSAAALHLRQQLQDAGIAVDAQHPLFVYLPCGVGGAPAGITFGLRQVLG
AHVHCFFAEPVQSPCFMVQMMAGQGAHPSVYDWGLTNRTEADGLAVPRASLPAAELMEPL
LSGCFTVCDDTLFRQLVQVLDATGERIEPSAAAGLSGPGFLTGTETGRTWLHAQGLWPHL
AQATHLVWTTGGLYVPPEAYARFEERGRALG
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgccctccgttgtttccccacaggaccgcttgcaggacgacgccccggctgcacaactg
cgccgcgccgagccctgcctatggctcaacccgcacaggcagcccatacccgccgcacgg
caggccgtggccggtgatcacattagtctggatgatacaaaggaggcggcggcacgcttc
gcgcgctttgcgccgctgctggagggcgtgttccccgagttgcaggcgacggggggcgtg
atcgagtcgcccctgttacccgcatccagcctgcatgccgcggcggggctcgtcgcgggc
cagggcgcgctgtggatcaaggcggaccaccggttgcccgtggccgggtccatcaaggca
cgcggaggcatccatgaagtgctggagctggccgagcgcctggcactgcagcacggcctg
ctgacgccgcagtccgatgccgacgactaccgcgccctggcaaaccccgctgcgcgcgcc
gtgtttgcgcgctacaccgtggccgtgggctccacgggcaacctgggcctgagcatcggc
gtggcggcatcggcgctgggttttcacgccgtggtgcacatgtcggccgatgccaaggaa
tggaagaagcagcgtctgcgccagcgcggcgtgcaggtggtggagcacgcgggtgactac
gagggcgctgtggccgcggggcgtgcgcaggcggcgcaggacccgttcagccatttcgtg
gacgacgaacgctcgctgtcgctgctgctgggttacagcgccgcggcgctacacctgcgc
cagcagttgcaggacgcgggcatcgccgtggacgcgcagcaccccctgttcgtctacctg
ccctgcggggtgggcggggcgccggcgggcatcaccttcggcctgcggcaggtgctgggg
gcgcatgtgcactgcttcttcgcggagcccgtgcagtcgccgtgtttcatggtgcaaatg
atggccggacagggcgcacacccctcggtgtacgactggggcctcaccaaccggacggaa
gccgacggcctggccgtgccacgcgcgtccctgcccgcggccgagctgatggagccgctg
ctgtcgggctgcttcaccgtgtgcgacgacaccctgtttcgccaactggtacaggtgctg
gatgccacgggcgagcgcatcgagccgtccgcagcggcgggcctgagcggccccggtttc
ctgacgggcaccgagacgggccgcacctggctgcacgcgcaaggtctgtggccccacctg
gcgcaggccacgcacctggtgtggaccaccggcgggctgtacgtgccgcccgaggcctac
gcgcgcttcgaggaacgtggccgggccctgggttga

DBGET integrated database retrieval system