KEGG   Acidovorax ebreus: Dtpsy_1682Help
Entry
Dtpsy_1682        CDS       T00853                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dia  Acidovorax ebreus
Pathway
dia00071  Fatty acid degradation
dia00072  Synthesis and degradation of ketone bodies
dia00280  Valine, leucine and isoleucine degradation
dia00310  Lysine degradation
dia00362  Benzoate degradation
dia00380  Tryptophan metabolism
dia00620  Pyruvate metabolism
dia00630  Glyoxylate and dicarboxylate metabolism
dia00640  Propanoate metabolism
dia00650  Butanoate metabolism
dia00900  Terpenoid backbone biosynthesis
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
dia01212  Fatty acid metabolism
dia02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtpsy_1682
   00630 Glyoxylate and dicarboxylate metabolism
    Dtpsy_1682
   00640 Propanoate metabolism
    Dtpsy_1682
   00650 Butanoate metabolism
    Dtpsy_1682
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Dtpsy_1682
   00072 Synthesis and degradation of ketone bodies
    Dtpsy_1682
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dtpsy_1682
   00310 Lysine degradation
    Dtpsy_1682
   00380 Tryptophan metabolism
    Dtpsy_1682
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtpsy_1682
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dtpsy_1682
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Dtpsy_1682
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dia04147]
    Dtpsy_1682
Enzymes [BR:dia01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dtpsy_1682
Exosome [BR:dia04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtpsy_1682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ACM33140
UniProt: B9MIX4
Position
1783808..1784986
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAVRTPVGKFGGALAKTPATDLGAIVIREALARARVAPDQVGEVIMGQVLAAG
CGQNPARQAMMKAGLAQETPALTINAVCGSGLKAVMLAAQAVATGDSEIVVAGGQENMSL
APHVLNGSREGQRMGDWKLVDTMIVDGLWDVYNQYHMGITAENVARQHGITREMQDALAL
ASQQKAAAAQDAGRFTDEIVPVTLAQKKGDPVIFAADEYLNRKTSAEALAGLRPAFDKAG
SVTAGNASGINDGAAAVVVMSATKAAALGLQPLARIAAYGTSGLDPATMGMGPVPASRKA
LQRAGWSVGDVDLFELNEAFAAQACAVNKELGIDPAKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMQRRDARKGLAALCIGGGMGVSMALAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttccgccgtgcgcacgcccgtgggcaagtttggcggcgca
ctggccaagacccccgcgaccgatctgggcgccatcgtcatccgtgaggcgctggcacgc
gcccgcgtcgctcccgatcaggtgggcgaggtcatcatgggccaggtgcttgcggccggc
tgtggccagaacccggcccgccaggccatgatgaaggcggggctggcccaggagacgccc
gcgctcaccatcaacgccgtgtgcggctcgggtctcaaggccgtgatgctggccgcccag
gccgtggcgacgggcgacagcgagatcgtcgtggccggcggccaggagaacatgagcctg
gcaccgcacgtgctcaatggctcgcgcgaaggccagcgcatgggcgactggaagctggtc
gacaccatgatcgtcgacggcctgtgggacgtgtacaaccagtaccacatgggcatcacg
gccgagaacgtggccaggcagcacggcatcacgcgcgagatgcaggatgcgctggccctg
gccagccagcaaaaggccgccgccgcccaggacgcagggcgcttcacggacgagatcgtg
ccggtgacacttgcgcagaagaagggcgaccccgtcatattcgcggcagacgaatatctc
aaccgcaaaaccagtgccgaagctctggctggcctgcgccccgctttcgacaaggccggc
tcggtcacggcgggcaatgcctcgggcatcaatgacggtgcggccgccgtggtggtgatg
agtgccaccaaggctgcggccctgggcctgcaaccgctggcccgcattgcggcctacggc
accagcggactggaccccgccaccatgggcatgggcccggtgccggcatcccgcaaggca
ctgcagcgcgcgggctggagcgtgggcgatgtggacctgttcgaactcaacgaggccttc
gctgcccaggcgtgcgcggtgaacaaggagctcggcatcgatcccgccaaggtcaacgtg
aatggcggcgccatcgccatcggtcaccccatcggcgcctcgggctgccgcgtgttggtg
accctgctgcacgaaatgcagcgccgcgatgccaggaagggcctggctgcgctgtgcatt
ggtggaggcatgggcgtgtccatggcattggcgcgttaa

DBGET integrated database retrieval system