KEGG   Acidovorax ebreus: Dtpsy_1835
Entry
Dtpsy_1835        CDS       T00853                                 

Definition
(GenBank) type I secretion outer membrane protein, TolC family
  KO
K12340  outer membrane protein
Organism
dia  Acidovorax ebreus
Pathway
dia01501  beta-Lactam resistance
dia01503  Cationic antimicrobial peptide (CAMP) resistance
dia02020  Two-component system
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_1835
  09132 Signal transduction
   02020 Two-component system
    Dtpsy_1835
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Dtpsy_1835
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Dtpsy_1835
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dia02000]
    Dtpsy_1835
   02044 Secretion system [BR:dia02044]
    Dtpsy_1835
   01504 Antimicrobial resistance genes [BR:dia01504]
    Dtpsy_1835
Transporters [BR:dia02000]
 Other transporters
  Pores ion channels [TC:1]
   Dtpsy_1835
Secretion system [BR:dia02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Dtpsy_1835
  RTX toxin transporter
   Dtpsy_1835
  RaxAB-RaxC type I secretion system protein
   Dtpsy_1835
  AlgE-type Mannuronan C-5-Epimerase transporter
   Dtpsy_1835
Antimicrobial resistance genes [BR:dia01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AcrEF-TolC [MD:M00696]
    Dtpsy_1835
   Multidrug resistance, efflux pump MdtEF-TolC [MD:M00697]
    Dtpsy_1835
SSDB
Motif
Pfam: OEP DUF2970
Other DBs
NCBI-ProteinID: ACM33292
UniProt: B9MJF4
Position
complement(1954066..1955409)
AA seq 447 aa
MTSLQRLLSVSLAVGVCALGALPAQAQSLSTLVEWARSYDAPWQAAQAQLQAADSRAEQA
RAGLLPSAALNGGVTYARTDLTRGPLPPLDLHAPTQTVGVVASQPLYRPANRIGFEQGQR
GIDIARAQRDGAEQDLLVRVSQAYFDVLAAQDTLTFMQAQKAAVAEQLAAAKRNFEVGTA
TVTDEREAHARHDLVSAQEIAAENDLHVKRLALEQTVGRSGLTPLPLAQPVQLPAVQPAD
VNSWVHVAEDQQPQVRQAAIALDVARLETAKAETGHLPTVDLQAGYSVQRTPNGTVTMPG
VHSRANVASVGVALNLPLFAGFAVQNRVKETLSLEDKARADLDHARRSVAQATRAAFFGV
QSGQSQVRALQAAEASTQSALEANQLGYEVGVRINIDVLNAQSQLYQTKRDLAVARYNVL
MGTLRLKQAAGTLSMDDVVAVDSLLSR
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgacatcactgcaacggttgctctccgtttccctggccgtgggcgtctgcgcgctgggc
gccctgcccgcgcaggcgcagagcctgtccacgctggtggaatgggcgcgcagctatgac
gccccgtggcaggccgcgcaggcacagttgcaggccgccgacagccgtgccgagcaggcg
cgcgcaggactgttgcccagcgccgcgctgaatgggggcgtgacctacgcccgcaccgac
ctgacccgtggccccctgcccccgctggacctgcacgcccctacccagaccgtgggcgtg
gtggcctcgcagccgctgtaccggccggccaaccgcatcggcttcgagcaggggcagcgc
gggatcgacattgcccgcgcgcagcgtgacggggccgagcaggacctgctggtgcgcgtg
agccaggcgtatttcgatgtgctggccgcccaggacaccctgaccttcatgcaggcccaa
aaggctgccgtggccgaacaactggccgcggccaagcgcaatttcgaggtcggcaccgcc
acggtgaccgacgagcgcgaggcccacgcgcggcacgacctggtgtcggcccaggagatc
gcggccgagaacgacctgcacgtcaagcgcctggcactggagcagaccgtgggccgctcg
ggcctgaccccgctgcccctggcccagccggtgcagctgcccgcggtgcagccggccgat
gtgaacagctgggtgcacgtcgcggaagatcagcaaccccaggtgcgccaggcagccatc
gcgctggacgtggcgcgcctggagaccgccaaggccgagaccggccacctgcccacggtg
gatctgcaggcgggctacagcgtgcagcgcacgcccaacggcaccgtcaccatgccgggc
gtgcactcccgtgccaacgtcgccagcgtgggcgtggcgctcaacctgccgctgttcgcg
ggcttcgcggtgcaaaaccgggtgaaggaaaccctgtcgctggaagacaaggcgcgcgcc
gacttggaccatgcgcgccgcagcgtggcccaggccacgcgcgccgcgttcttcggcgtg
cagtcgggccagagccaggtgcgggcgctgcaggcggccgaggcgtccacccagagcgcg
ctggaagccaaccagctgggctacgaggtgggcgtgcgcatcaacatcgacgtgctcaac
gcccagagccagctctaccagaccaagcgcgacctggccgtggcacgctacaacgtgctc
atgggcacgctgcgcctcaagcaggccgccggcaccttgtccatggacgacgtggtggcg
gtggacagcctgctgagtcgctga

DBGET integrated database retrieval system