KEGG   Acidovorax ebreus: Dtpsy_2224Help
Entry
Dtpsy_2224        CDS       T00853                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
dia  Acidovorax ebreus
Pathway
dia00860  Porphyrin and chlorophyll metabolism
dia00970  Aminoacyl-tRNA biosynthesis
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dia00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dtpsy_2224
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Dtpsy_2224
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dia01007]
    Dtpsy_2224
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dia03016]
    Dtpsy_2224
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:dia02048]
    Dtpsy_2224
Enzymes [BR:dia01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Dtpsy_2224
Amino acid related enzymes [BR:dia01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Dtpsy_2224
Transfer RNA biogenesis [BR:dia03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Dtpsy_2224
 Prokaryotic Type
   Other AARSs
    Dtpsy_2224
Prokaryotic defense system [BR:dia02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Dtpsy_2224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ACM33662
UniProt: B9MBI3
Position
complement(2366240..2367649)
Genome map
AA seq 469 aa AA seqDB search
MTQQQVRTRFAPSPTGFIHLGNIRSALYPWAFARANDGVFILRIEDTDLERSTQASVDVI
LEGMSWLQLDHDEGPYYQMQRMERYKEVLAQLQAAGHVYPCYMSVEELDALRERQMAAKE
KPRYDGTWRPEPGKVLPPVPEGVKPVLRFKTPQDGVVGWDDKCKGRIEFQNSELDDLVIA
RPDGTPTYNFCVCVDDMDMRITHVIRGDDHVNNTPRQIHIFEALGATVPVFAHLPTVLNE
QGEKMSKRNGAKAVTQYRDEGYLPDAMVNYLARLGWSHGDDEIFSRAQFLEWFNLDHLGR
SAGQFDEAKLRWVNAQHLKAMEDAQLAALVRPFVVQAGVPEAQLDADDRLPRICALFKDR
CETLVDLARWARVFYVDAIEPDADDFAKHVTETATPALDAFAAAMETVAWNKDAINAAIK
DVLKQLGLKMPQLAMPVRVLTMGTAHTPSVDAVLELLGREKILARLKSR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaacaagtacgcacccgtttcgccccgtcgcccacgggcttcatccacctg
ggcaatatccgctccgcgctctatccctgggccttcgcgcgtgccaacgacggcgtgttc
atcctgcgcattgaggacactgatctggagcgctccacccaggcctcggtcgacgtcatc
ctggagggcatgtcctggctgcagctcgaccatgacgagggcccgtactaccagatgcag
cgcatggagcgctacaaggaagtcctggcccaactgcaggctgcaggccatgtctatccc
tgctacatgagcgtggaagagctcgatgccttgcgtgaacgccagatggccgcgaaggaa
aagccccgctatgacggcacttggcgccccgaacccggcaaggtgctgccgcccgtgccg
gaaggcgtgaagcctgtgctgcgcttcaagacgccccaggacggcgtagtcggctgggac
gacaagtgcaagggtcgcatcgagtttcagaacagcgagctggacgacctggtcatcgcg
cgcccggacggcacgcccacctacaacttctgcgtttgtgtggacgacatggacatgcgc
atcacccacgtgattcgcggcgacgaccatgtgaacaacacaccacgccagatccacatc
ttcgaggccctgggtgccacggtgcccgtgttcgctcatctgcccaccgtgctcaacgag
cagggtgagaagatgagcaagcgcaacggtgccaaggccgtgacacagtaccgcgacgag
ggctatctgcccgacgccatggtcaactacctggcccgattgggctggagccatggcgat
gacgagatcttcagccgcgcgcaattcctggaatggttcaacttggatcacctgggccgc
agcgccggccagttcgacgaggccaagttgcgctgggtgaacgcacagcatctcaaggcc
atggaagatgcgcagttggcagcactcgtgcggcccttcgtcgtgcaggcgggtgttcca
gaggcgcagttggatgctgatgaccgcttgccgcgcatctgcgcgctgttcaaagaccgc
tgcgaaacgctggtggacctggcacgctgggcgcgcgtgttctatgtggacgccatcgag
cccgatgcagacgacttcgcgaagcacgtgactgaaaccgccacaccggcgctcgacgcg
tttgccgccgccatggagaccgtggcgtggaacaaggacgcaatcaacgctgcgatcaag
gatgtcctcaagcagctgggtttgaagatgccgcaactcgcaatgcccgtgcgggtgctg
accatgggtaccgcgcatacgccgtcggtggatgccgtgctcgaactgctgggtcgcgaa
aaaatcctcgcgcgattgaaaagtcgttaa

DBGET integrated database retrieval system