KEGG   Acidovorax ebreus: Dtpsy_2284Help
Entry
Dtpsy_2284        CDS       T00853                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dia  Acidovorax ebreus
Pathway
dia00020  Citrate cycle (TCA cycle)
dia00190  Oxidative phosphorylation
dia00650  Butanoate metabolism
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01200  Carbon metabolism
Module
dia_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dia_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dia_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dtpsy_2284
   00650 Butanoate metabolism
    Dtpsy_2284
  Energy metabolism
   00190 Oxidative phosphorylation
    Dtpsy_2284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ACM33722
UniProt: B9MBP3
Position
2428091..2428456
Genome map
AA seq 121 aa AA seqDB search
MSVNYGSKRTVVGAHYGVRDWLVQRATAVLMALFTLVLLACVIFSKGPIGYDLWAGIFSS
QWMKVLTLSVIVALAWHAWVGVRNVWMDYIKPAGLRLTLQVFTIVWLVACTGWGIQVLWR
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtgaattacggctccaagcgcaccgtcgtgggtgcccactatggcgtgcgcgac
tggctggtgcagcgcgccaccgccgtcttgatggctttgttcaccctggtgctgctggcc
tgcgtcatcttcagcaagggccccatcggctacgacctgtgggccggcatcttctccagc
cagtggatgaaggttctgaccctgtccgtcatcgtggcgctggcctggcacgcctgggta
ggcgtgcgcaacgtgtggatggactacatcaagccggcaggcctgcgtctgacgctgcaa
gtcttcaccatcgtctggctggtggcctgcaccggctggggcatccaggttctgtggcgt
ctctga

DBGET integrated database retrieval system