KEGG   Acidovorax ebreus: Dtpsy_2383Help
Entry
Dtpsy_2383        CDS       T00853                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dia  Acidovorax ebreus
Pathway
dia00040  Pentose and glucuronate interconversions
dia00052  Galactose metabolism
dia00500  Starch and sucrose metabolism
dia00520  Amino sugar and nucleotide sugar metabolism
dia01100  Metabolic pathways
dia01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dtpsy_2383
   00052 Galactose metabolism
    Dtpsy_2383
   00500 Starch and sucrose metabolism
    Dtpsy_2383
   00520 Amino sugar and nucleotide sugar metabolism
    Dtpsy_2383
Enzymes [BR:dia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dtpsy_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACM33820
UniProt: B9MCB5
Position
2538387..2539274
Genome map
AA seq 295 aa AA seqDB search
MNAPTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMVFVT
GRSKRAIEDHFDTAYELENELENAGKREMLALVRSIAPDDMNCLFVRQPRSLGLGHAVLC
AEPLVGNEPFAVILADDLMTGEPGGPGVMAQMTAAFAKQGRSLLAVQEVPLEHTKRYGIV
KGESAGGALIRVDEIVEKPAPEKAPSRMGVAGRYVLTPRIFEEIRNQPQGVGGEIQLTDA
IARLMQHETVYAYQYAGKRYDCGSKEGFLEATVELALQHPQVGPQFREYLQSLAL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgcacccacccgtgtccgcaaggccgtctttcccgtcgcagggctcggcacccgc
ttcctgcccgccaccaaggcatcgcccaaggagatgctgccggtggtggacaagcccctg
atccagtacgcggtcgaggaggcctacgaggccggcatccgcgacatggtgttcgtcacc
ggccgcagcaagcgcgcgatcgaagaccatttcgataccgcgtacgaactggagaacgag
ctggagaacgccggcaagcgcgagatgctcgcgctggtgcgcagcatcgcgcccgacgac
atgaactgcctgtttgtgcgccagccacgctcgctgggcctgggccatgccgtgctgtgc
gccgagcccctggtgggcaacgagccctttgccgtcatcctggccgacgacctgatgacc
ggcgagcccggcggccccggcgtgatggcgcagatgacggccgctttcgccaagcagggg
cgctcgctgctggccgtgcaggaagtcccgctggagcacaccaagcgctacggcatcgtc
aagggcgagagcgctggcggcgcgctgatccgcgtcgacgagatcgtggaaaagcccgcg
cccgaaaaggcaccgtcacgcatgggcgtggccggccgctatgtgctcacgccgcgcatc
ttcgaagagatccgcaaccagccgcagggcgtgggaggcgagatccaactcaccgatgcg
atcgcgcgcctgatgcagcacgagacggtgtatgcctaccagtacgccggcaaacggtac
gactgcggcagcaaggaaggctttttggaagccacggtcgaactggcactgcagcacccc
caggtgggcccacagttccgcgaatacctccaatccctggcgctgtaa

DBGET integrated database retrieval system