KEGG   Acidovorax ebreus: Dtpsy_2763Help
Entry
Dtpsy_2763        CDS       T00853                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dia  Acidovorax ebreus
Brite
KEGG Orthology (KO) [BR:dia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Dtpsy_2763
Enzymes [BR:dia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Dtpsy_2763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ACM34197
UniProt: B9MEF8
Position
2941676..2942554
Genome map
AA seq 292 aa AA seqDB search
MSILLNADLHCHSVVSDGTLTPEALAARAHANGVALWALTDHDEIGGQHRAAAAAHALGM
DYLTGTEISVTFADTTVHIVGLGFDPDNAQLAQGLAATRGGRSERAQEMAQQLAHVGIRG
AFEGALRYAGNPELVSRTHFARFLVETGVCHDTSEVFRRFLTEGNPGYVPHRWATLGNAV
RWIREAGGMAVIAHPARYRFTANEEYALFSEFKQHGGQGVEVVTGSHTPSEYPVYAAMAQ
EFGMAASRGSDFHSPNESHTDLGALPDLPGQLTPVWELLSDRILRAPRTTAG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgtccatcctcctcaatgccgacctccactgccactccgtggtgtctgacggcaccctc
acacccgaagcgctggcagcccgtgcgcatgccaacggtgtagcgctgtgggcgctgacg
gatcatgacgagatcggcggccagcaccgcgccgccgccgccgcgcacgcgctgggcatg
gactacctcacgggcacagagatctcggtcaccttcgccgacaccacggtgcatatcgtg
ggactggggttcgacccggacaatgcacaactcgcccagggcctcgcggccacgcgcggc
gggcgcagcgaacgggcacaggagatggcgcagcaactcgcgcacgtgggtatccgcggc
gcattcgaaggggcgttgcgctacgcgggcaaccccgaactggtctcgcgcacgcacttt
gcccgcttcctcgtggagactggcgtgtgccacgacacctccgaagtgttccggcgcttt
ctcaccgagggcaaccccggctacgtaccccaccgctgggccacgctgggcaatgcggtg
cgctggatccgcgaggccggcggcatggccgtgatcgcccatcctgcacgctaccgattc
acggcgaatgaggaatacgccttgttttccgagttcaagcagcacggcggccagggcgtg
gaagtggtaaccggcagccatacgccatccgaatatcccgtgtacgccgccatggcgcag
gagttcggcatggccgcctcgcgcggcagcgacttccacagcccgaacgaatcacacacc
gacctgggcgccctgccggatttgccaggccagctcacccccgtgtgggagctgttgtcc
gatcgcatcctgcgcgccccccgcaccactgccggctga

DBGET integrated database retrieval system