KEGG   Acidovorax ebreus: Dtpsy_2825
Entry
Dtpsy_2825        CDS       T00853                                 

Definition
(GenBank) protein-export protein SecB
  KO
K03071  preprotein translocase subunit SecB
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_2825
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_2825
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_2825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dia03110]
    Dtpsy_2825
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_2825
Chaperones and folding catalysts [BR:dia03110]
 Other chaperones and cochaperones
  SecB
   Dtpsy_2825
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_2825
SSDB
Motif
Pfam: SecB
Other DBs
NCBI-ProteinID: ACM34259
UniProt: B9MEY9
Position
complement(3011118..3011570)
AA seq 150 aa
MAEETPVFQIQRVYLKDLSLEQPNSPAILLEQEQPSVDIQLGVEATPVVEGIFEVAVTAT
VQTKIKDKTVFLVEAKQAGIFEIRNVPEDQMGAIIGIACPQIIYPYLRGNVADTVTRAGF
PPVHLAEINFQAMYEQQQAAAAEAATSTAQ
NT seq 453 nt   +upstreamnt  +downstreamnt
atggccgaagaaacccccgtgttccagattcagcgcgtgtacctgaaggacctgtcgctg
gagcagcccaattcgcccgcgatcctgctggagcaggagcagcccagcgtggacatccag
ttgggggtcgaggccacacccgtggtcgaaggcatctttgaagtggccgtgaccgccacc
gtgcagaccaagatcaaggacaagaccgtgttcctggtggaggccaagcaggccggcatc
ttcgagatccgcaacgtgcccgaggaccagatgggcgccatcatcggcattgcctgcccc
cagatcatctacccctacttgcgcggcaacgtggccgacaccgtgacgcgtgcgggcttt
ccgcccgtgcacctggccgagatcaacttccaggccatgtacgagcagcaacaggccgca
gccgccgaggctgccaccagcacagcccagtaa

DBGET integrated database retrieval system