KEGG   Acidovorax ebreus: Dtpsy_2843
Entry
Dtpsy_2843        CDS       T00853                                 

Definition
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_2843
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_2843
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_2843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_2843
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_2843
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_30 Zeta_toxin AAA_16 CbiA MMR_HSR1 AAA_17 MeaB AAA_22 AAA_33 APS_kinase AAA_19 DUF2075 Thymidylate_kin Viral_helicase1 ABC_tran KAP_NTPase ATP_bind_1 DUF3987 MobB AAA_18 TerB_C AAA_31 ArsA_ATPase NTPase_1 Fer4_NifH Helicase_RecD
Other DBs
NCBI-ProteinID: ACM34277
UniProt: B9MF07
Position
3025453..3026601
AA seq 382 aa
MFSFFKKKPPTPTEPALAPEDVASPAAPPAADAPASGGAFGWLRKPFGAGATSVADPAAP
SAGAPAAIDAPLAVPEPTPKPGGARQGWMDRLKSGLRKTGSSIATVFTGTQINDALYDEL
EEALLMADTGVKATQHLLEDLKRRVKETKTTEPAAVKGLLADALADLLRPLEKPLVIGEH
TPTVIMVAGVNGAGKTTSIGKLTKHLADHGESVLLAAADTFRAAAREQLGVWATRNTVEI
VSQEGGDPAAVSFDAVTAGRARGKDVVLVDTAGRLPTQLHLMEELKKIRRVVTKADASAP
HEVLLVIDGNTGQNALAQVRAFDDALQLTGLIVTKLDGTAKGGVLAAIAQERPVPVYFIG
VGEKVEDLETFSAREFAQALLT
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgttcagttttttcaagaagaaaccgcccacccccaccgaacccgcccttgcacccgag
gacgtggccagccctgcggcgccgcccgcggccgacgcccccgccagcggcggcgcattc
ggctggctgcgcaagccctttggcgcaggcgccaccagcgtggcggacccggctgcccct
tcggccggtgcccccgcagccatcgacgcgccccttgccgtccccgagcccaccccgaag
cccgggggcgcacgccagggctggatggaccggctgaaatccggcctgcgcaagaccggc
agcagcatcgcgaccgtcttcacgggcacgcagatcaacgacgcgctgtacgacgagctg
gaggaagccctgctcatggccgacaccggggtgaaagccacacagcacctgctggaggac
ctcaagcgccgcgtgaaagaaaccaagaccaccgagcctgctgccgtaaagggactgctg
gccgatgcgctggccgacctgctgcggccgctggaaaagccgctggtgatcggcgagcac
acacccaccgtgatcatggtggccggcgtgaacggcgcgggcaagaccacctccatcggc
aagctcaccaagcacctggccgaccatggcgagagcgtgctgctggccgccgccgatacc
ttccgcgccgcggcgcgcgagcagttgggtgtctgggccacgcgcaacacggtggagatc
gtcagccaggaagggggcgaccctgccgccgtgagctttgacgccgttaccgccggccgc
gcgcgcggcaaagatgtggtgctggtggacactgccggccgcctgcctacgcagctgcac
ctgatggaagagctgaagaagatccgccgcgtggtcaccaaggccgatgccagcgccccg
cacgaggtgctactggtgatcgacggcaacaccggccagaacgccctggcgcaggtgcgc
gcgttcgacgacgcgcttcaactcaccggcctgatcgtcaccaaactggacggcacggcc
aagggcggcgtgctggccgccatcgcgcaggagcggcccgtgcccgtgtacttcattggc
gtgggcgagaaggtggaagacctggagaccttcagcgcacgcgaattcgcccaggccctg
ctgacctga

DBGET integrated database retrieval system