KEGG   Acidovorax ebreus: Dtpsy_2933Help
Entry
Dtpsy_2933        CDS       T00853                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dia  Acidovorax ebreus
Pathway
dia00071  Fatty acid degradation
dia00280  Valine, leucine and isoleucine degradation
dia00281  Geraniol degradation
dia00310  Lysine degradation
dia00360  Phenylalanine metabolism
dia00362  Benzoate degradation
dia00380  Tryptophan metabolism
dia00410  beta-Alanine metabolism
dia00627  Aminobenzoate degradation
dia00640  Propanoate metabolism
dia00650  Butanoate metabolism
dia00903  Limonene and pinene degradation
dia00930  Caprolactam degradation
dia01100  Metabolic pathways
dia01110  Biosynthesis of secondary metabolites
dia01120  Microbial metabolism in diverse environments
dia01130  Biosynthesis of antibiotics
dia01212  Fatty acid metabolism
Module
dia_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:dia00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dtpsy_2933
   00650 Butanoate metabolism
    Dtpsy_2933
  Lipid metabolism
   00071 Fatty acid degradation
    Dtpsy_2933
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dtpsy_2933
   00310 Lysine degradation
    Dtpsy_2933
   00360 Phenylalanine metabolism
    Dtpsy_2933
   00380 Tryptophan metabolism
    Dtpsy_2933
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dtpsy_2933
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dtpsy_2933
   00281 Geraniol degradation
    Dtpsy_2933
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dtpsy_2933
   00627 Aminobenzoate degradation
    Dtpsy_2933
   00930 Caprolactam degradation
    Dtpsy_2933
Enzymes [BR:dia01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dtpsy_2933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACM34367
UniProt: B9MFL6
Position
3118042..3118821
Genome map
AA seq 259 aa AA seqDB search
MAYECIEVRTEADKVGIITLARPKQLNALNDQLMTELGEALKAFDADEKIGCIILTGSEK
AFAAGADIGAMAKYSFADAYKGDYITRNWEQIRSIRKPVIAAVSGYALGGGCELAMMCDF
IIAADNAKFGQPEIKLGVIPGAGGTQRLPRAVGKAKAMDMALTGRMMDATEAERSGLVSR
VVPLDKLMEEALGAALVISGFSQIAVMAAKESVNRAFEGTLSDGVMFERRLFHALFATQD
QKEGMDAFVNKRAAVFTHQ
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggcctacgaatgcatcgaagtccgcaccgaagcggacaaggtcggcatcatcacgctc
gcccgtcccaagcagctcaacgcgctcaacgaccagctcatgaccgagctgggcgaggcc
ctcaaggcgttcgacgccgacgagaagatcggctgcatcatcctgacgggcagcgagaag
gccttcgccgcgggcgccgacatcggcgccatggccaagtacagctttgccgatgcgtac
aagggcgactacatcacgcgcaactgggagcagatccgcagcatccgcaagcccgtcatc
gcggcggtgagcggctacgccctgggcggcggctgcgagctggccatgatgtgcgacttc
atcatcgcggcggacaatgccaagttcggacagcccgaaatcaagctgggcgtgatcccc
ggcgcgggcggcacgcagcgcctgccgcgcgccgtgggcaaggccaaggccatggacatg
gccctcaccggccgcatgatggacgccacggaagccgagcgctccggcctcgtcagccgc
gtggtgccgctggacaagctgatggaagaagccctgggcgcggccctcgtcatcagcggt
ttctcgcagatcgccgtgatggccgccaaggaatcggtgaaccgcgccttcgaagggact
ttgagcgatggcgtgatgttcgagcgccgcctgttccatgcgctgttcgccacccaggac
cagaaggaaggcatggacgccttcgtgaacaagcgcgccgcagtcttcacgcaccaataa

DBGET integrated database retrieval system