KEGG   Acidovorax ebreus: Dtpsy_2936
Entry
Dtpsy_2936        CDS       T00853                                 

Definition
(GenBank) signal recognition particle protein
  KO
K03106  signal recognition particle subunit SRP54 [EC:3.6.5.4]
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_2936
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_2936
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_2936
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_2936
Enzymes [BR:dia01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.4  signal-recognition-particle GTPase
     Dtpsy_2936
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_2936
  Eukaryotic Sec-SRP protein
   Dtpsy_2936
SSDB
Motif
Pfam: SRP54 SRP_SPB SRP54_N CbiA Zeta_toxin APS_kinase AAA_33 FliG_N DUF3612 AAA_16 AAA_18 AAA_31 AAA_19 AAA_22 ResIII AAA_24 Thymidylate_kin MMR_HSR1 AAA_14 cobW ABC_tran TsaE AAA_17 ArsA_ATPase KTI12 HTH_Crp_2 Rad17 AAA_28
Other DBs
NCBI-ProteinID: ACM34370
UniProt: B9MFL9
Position
complement(3121083..3122462)
AA seq 459 aa
MASALTEKLTRLVKEMRGQARITEANVQDMLREVRMALLEADVALPVVRDFIARVKEKAL
GQEVLGSLKPGQALVGIVNKELAATMGEGVADINLNAQPPAVILMAGLQGAGKTTTTAKL
AKHLIEKRKKKVLTVSGDVYRPAAIEQLKTVTKQAGAEWFPSTPDQKPSDIALGALDYAK
KHFFDVLLVDTAGRLAIDEVLMQEIKDLHAVLNPVETLFVVDAMQGQDAVNTAKAFKEAL
PLTGIVLTKLDGDSRGGAALSVRQVTGAPIKFAGVSEKIDGLEVFDAERHAGRILGMGDI
VALVEQVTAGVDMEAAQKLAAKVKSGDGFDLNDFLAQLQQMKQMGGLSSLMDKLPAQLTA
KAGQVDMDKAERDIRRKEGIICSMTALERRKPELIKATRKKRIAQGAGVQVQEVNRLLNE
FEQMQGMMKKMKGGGLMKLMKKMGGMKGGLPGMGGMPRF
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggcctccgcactcaccgaaaaactcacccgtctcgtcaaggagatgcgcggccaggcc
cgcatcaccgaagccaacgtgcaggacatgctgcgcgaggtgcgcatggccctgctggag
gccgacgtggcgctgcctgtggtgcgcgacttcatcgcccgcgtgaaggaaaaagccctg
ggccaggaggtactgggcagcctgaagcccggccaggcgctggtgggcatcgtgaacaag
gaactggccgcgaccatgggcgagggcgtggccgacatcaacctcaacgcgcagccgccg
gcggtgatcctgatggccggcctgcagggcgcgggcaagaccaccaccacggccaagctg
gccaagcacctgatcgaaaagcgcaagaagaaggtgctgaccgtctcgggcgacgtgtac
cgccccgccgccatcgagcagctcaagaccgtgaccaagcaggccggcgccgagtggttc
cccagcacgcccgaccagaagccgagcgacatcgcccttggagcgctggactacgccaag
aagcacttcttcgacgtgctgctggtagacacggccggccgcctggccatcgacgaggtg
ctgatgcaggaaatcaaggacctgcatgccgtgctgaacccggtggagacgctgtttgtc
gtcgatgccatgcagggccaggacgcggtgaacaccgccaaggctttcaaggaagcgctg
ccgctcacgggcatcgtgctcacaaaattggacggtgactcgcgcggcggtgcggcgctg
tcggtgcgccaggtgacgggcgcgccgatcaagtttgccggcgtttccgaaaagatcgac
ggcctggaggtgttcgacgccgagcgccacgcgggccgcatcctgggcatgggcgacatc
gtcgcgctggtcgagcaggtcacggccggcgtggacatggaggcggcgcaaaagctcgcc
gccaaggtcaagagcggcgacgggttcgatctgaacgacttcctggcccagttgcagcag
atgaagcagatgggcggcctgtccagcctcatggacaagctgcccgcgcagctcacggcc
aaggcaggtcaggtggacatggacaaggccgagcgcgacatccgccgcaaggagggcatc
atctgcagcatgacggcgctggagcgccgcaagcccgagctcatcaaggccacacgcaag
aagcgcatcgcccagggcgccggcgtgcaggtgcaggaggtcaaccgcctgctcaacgag
ttcgagcagatgcagggcatgatgaaaaagatgaagggcggcggcctcatgaagctcatg
aagaagatgggcggcatgaagggcggcctgccgggcatgggaggcatgccgcggttctga

DBGET integrated database retrieval system