KEGG   Acidovorax ebreus: Dtpsy_3354
Entry
Dtpsy_3354        CDS       T00853                                 

Definition
(GenBank) protein-export membrane protein SecF
  KO
K03074  preprotein translocase subunit SecF
Organism
dia  Acidovorax ebreus
Pathway
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_3354
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_3354
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3354
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_3354
SSDB
Motif
Pfam: SecD_SecF Sec_GG DUF2721
Other DBs
NCBI-ProteinID: ACM34781
UniProt: B9MHS2
Position
complement(3581206..3582159)
AA seq 317 aa
MEFFRIKKDIPFMKYALVLNAVSFITFALAVFFLVTRGLHLSVEFTGGTVMEVAYTQTAD
IGKVRDTVAGLGYADVVVQNFGTSRDVMVRLPVQKGVTSAQQSEQVLSALKAQDPEVTLR
RTEFVGPQVGEELVHGGLMALGMVVLGIVIYLAFRFEWKFGVAAVIANLHDVVIILGFFA
FFQWEFSLSVLAGVLAVLGYSVNESVVIFDRIREAFRKFRKLNTHEVIDHAITSTMSRTI
ITHASTEAMVLSMFFFGGPSLHYFALALTIGILFGIYSSVFVAAAIAMWLGVKREDLVKA
PTRKEGDPADPNSGAVV
NT seq 954 nt   +upstreamnt  +downstreamnt
atggagtttttccgcatcaaaaaagacatcccgttcatgaagtacgcgttggtgctcaac
gcggtgtctttcatcactttcgcgctcgcggtgttcttcctggtcacgcggggcctgcac
ctgtcggtggagttcacgggtggcaccgtcatggaggtggcctacacgcagacagccgac
atcggcaaggtgcgcgacaccgtcgcgggcctgggctatgccgacgtggtggtgcagaac
ttcggcacctcgcgcgacgtgatggtccgcctgcccgtgcaaaagggcgtcacctcggcc
cagcaaagcgagcaggtgctgagcgcgttgaaggcgcaggaccccgaggtcacgctgcgg
cgcaccgagttcgtgggcccgcaggtgggcgaagaactggtgcatggcggcctgatggcg
ctgggcatggtggtgctgggcatcgtcatctacctggccttccgcttcgagtggaagttc
ggcgtggcagcggtgatcgccaacctgcacgacgtggtcatcattctgggcttctttgcg
ttcttccagtgggagttctcgctgtcggtgctggccggcgtgctggccgtgctgggctat
tcggtgaacgagtcggtggtgatcttcgaccgtatccgcgaggccttccgcaagttccgc
aagctcaatacgcatgaggtgatcgaccacgccatcacctccaccatgagccgcaccatc
atcacccacgcctccaccgaggccatggtgctgtccatgttcttcttcgggggccccagc
ctgcactacttcgcactggcgctgaccatcggcatcctgttcggcatctactcgtcggtg
ttcgttgccgcggccatcgctatgtggctgggcgtcaagcgcgaagacctggtcaaggcg
ccgacccgcaaggaaggcgacccggccgacccgaactccggcgccgtggtctga

KEGG   Acidovorax ebreus: Dtpsy_3355
Entry
Dtpsy_3355        CDS       T00853                                 

Definition
(GenBank) protein-export membrane protein SecD
  KO
K03072  preprotein translocase subunit SecD
Organism
dia  Acidovorax ebreus
Pathway
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_3355
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_3355
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3355
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_3355
SSDB
Motif
Pfam: SecD-TM1 SecD_SecF MMPL Sec_GG ACR_tran
Other DBs
NCBI-ProteinID: ACM34782
UniProt: B9MHS3
Position
complement(3582174..3584072)
AA seq 632 aa
MNRYPVWKYAILVIVLLIGALYTLPNFFGEAPAVQVSSAKATLKVDAAVQQRVEDALKAA
NVASDSIVFDGNSVRARFDTPDNQLKAKDAIEKALIPDPSDPSYIVALNLVSRSPDWLTA
LHARPMYLGLDLRGGVHFMLQVDMQAAITKKIESYAGDLRSALREKNIRHGGIGREGQAV
DIRVRDEATLTAARNLIADQFPDLAVVSSADGDGMRLRATIKPEALRKVQEQALKQNMVT
LHNRINELGVAEPVIQQQGLDRIVVQLPGVQDTAKAKDILGRTATLEVRMVDEGTEARAA
EMGTGPVPFGAEKYLDRNGQAVIVKKQVVLTGENLTDAQPGFDGQTQEPTVNLTLDAKGS
RIFKDITRENVGKRMAIVLFEKGKGEVVTAPVIRSEIGGGRVQISGRMTTAEANDTALLL
RAGSLAAPMEIIEEYTIGPSLGADNIDRGIQSVVWGMVAIAAFMCVYYMLFGVFSTIALG
VNVLLLIAILSMLQATLTLPGIAAMALALGVAIDSNVLINERIREELRAGVAPQAAIATG
YERAWATILDSNVTTLIAGLALLAFGTGPVRGFAVVHCIGILTSMFSAVFFSRGLVNLWY
GRKKKLKSVSIGQVWKPEGDEHRSVAARGNSN
NT seq 1899 nt   +upstreamnt  +downstreamnt
atgaaccgttatccggtctggaagtacgcgatcctggtgatcgtgttgctcattggggcc
ctgtataccctgcccaacttctttggcgaggcgcccgcggtgcaggtgtcgtcggccaag
gccacgctgaaggtcgacgccgcggtccagcagcgcgtcgaggacgcgctgaaagccgcc
aacgtggcctcggactccatcgtgttcgacggcaactcggtgcgcgcgcgctttgacacg
ccggacaaccagctcaaggccaaggacgcgatcgagaaggccctgatccccgacccgagc
gatccttcctacatcgtggcgctgaacctcgtgtcgcgctcgcccgactggctcaccgcg
ctgcatgcacggcccatgtacctcggcctggacctgcgcggcggcgtgcacttcatgctg
caggtggacatgcaggcggcgatcacgaagaagatcgagtcgtacgcaggcgacctgcgc
agcgcgctgcgcgagaagaacatccggcacggcggcatcggccgcgaagggcaggccgtg
gacatccgcgtgcgcgacgaggccacgctcacggcggcacgcaacctgatcgccgaccag
ttcccggacctggcggtcgtgagcagcgccgacggcgacggtatgcgcctgcgcgccacc
atcaagcccgaggccctgcgcaaggtgcaagagcaggccttgaagcagaacatggtcacg
ctgcacaaccgtatcaacgaactgggcgtggccgagcccgtgatccagcagcagggcctg
gaccgcatcgtggtgcaactgcccggcgtgcaggacacggccaaggccaaggacatcctg
ggccgcaccgccacgctggaagtgcgcatggtggacgagggcaccgaggcgcgcgccgcc
gaaatgggcacgggccccgtgccgttcggtgccgagaaatacctggaccgcaacggccag
gccgtgatcgtgaagaagcaggtcgtgctgaccggcgagaacctcaccgacgcgcagcca
ggattcgacggccagacccaggagcccaccgtgaacctcacgctggacgccaagggctcg
cgcatcttcaaggacatcacgcgcgagaacgtgggcaagcgcatggccatcgtgctgttc
gaaaagggcaagggcgaggtggtgaccgcgcccgtgatccgcagcgagattggcggtggt
cgcgtgcagatctccggccgcatgaccacggccgaggccaacgacaccgcactgctgctg
cgcgccggctcgctggccgcgcccatggagatcatcgaggaatacaccatcggcccgagc
ctgggtgccgacaacatcgaccggggtatccagtcggtggtctggggcatggtggccatc
gcggccttcatgtgcgtgtactacatgctgttcggtgtgttctccacgatcgcgctgggc
gtgaacgtgctgctgctgatcgccatcctgtcgatgctgcaggccacgctgaccctgccc
ggcatcgccgccatggccctggcgctgggcgtggccatcgactccaacgtgctgatcaac
gagcgcatccgcgaggagctgcgcgctggcgtggccccgcaggcggcgatcgccacgggc
tacgagcgcgcctgggccaccatcctggactccaacgtcaccacgctgatcgcgggcctg
gcgctgctggccttcggcacggggccggtgcgcggctttgccgtggtgcactgcatcggc
atcctgaccagcatgttctcggcggtgttcttctcgcgtggcctggtcaacctctggtat
ggccgcaagaagaagctcaagagcgtgtccatcggccaggtgtggaagcccgagggcgat
gagcaccgctcggtggctgcccgcggcaacagcaactaa

DBGET integrated database retrieval system