KEGG   Acidovorax ebreus: Dtpsy_3356
Entry
Dtpsy_3356        CDS       T00853                                 

Definition
(GenBank) preprotein translocase, YajC subunit
  KO
K03210  preprotein translocase subunit YajC
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_3356
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_3356
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_3356
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3356
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_3356
SSDB
Motif
Pfam: YajC Orf78 FCD
Other DBs
NCBI-ProteinID: ACM34783
UniProt: B9MHS4
Position
complement(3584167..3584499)
AA seq 110 aa
MLISSAFAQTAPAAAAEAGLMGSLTSMLPLVLMFVVLYFIMIRPQMKRQKEHRAMIDALA
KGDEVATAGGLLGKVAGLSEGYLQLEIAPGVQVQVQRSAVAQVLPKGTVK
NT seq 333 nt   +upstreamnt  +downstreamnt
gtgttgatttcttctgcttttgcacagaccgcccccgccgcagccgccgaggccggcctg
atgggatcgctcaccagcatgctgccgctggtgctgatgttcgtggtgctgtacttcatc
atgatccgtccccagatgaagcgccagaaggagcaccgcgccatgatcgacgcgctggcc
aagggcgacgaagtggccacggccggcggcttgctgggcaaggtggcgggcctgagcgaa
ggctacctgcaactggagattgcgcctggcgtgcaggtgcaggtgcagcgcagcgccgtg
gcccaggtgctgcccaagggcacggtcaagtaa

DBGET integrated database retrieval system