KEGG   Acidovorax ebreus: Dtpsy_3500Help
Entry
Dtpsy_3500        CDS       T00853                                 

Definition
(GenBank) P-type conjugative transfer protein TrbL
  KO
K07344  type IV secretion system protein TrbL
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_3500
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3500
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_3500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL
Motif
Other DBs
NCBI-ProteinID: ACM34925
UniProt: B9MII7
Position
complement(3750446..3751798)
Genome map
AA seq 450 aa AA seqDB search
MNDVTVIDRFLDTFSRYIDSGFGLLHGEVAFLTATLIVIDMTLAGLFWAMSHATGQGEDV
IAKLIRKVLYVGAFAYIIGNFNWLVGIVFRSFAGLGLTASGSTLSMENFLQPGRLAKVGI
DAGAPILKQIGDMAGFPEVFVNITPIVVMFLAWLIVLLCFFVLAIQLFITLIEFKLTTLA
GFVLVPFALWNKTAFLAEKVLGNVVSSGIKVLVLAVIVGIGSGLFAEFQVQPAEPSIDHS
VVVMLASLTLLALGIFGPGIATGLVSGGPQLGAGAMAGAALGAAGAAVAVGAAATGVGGA
VAAGARMAPAAARLAGSGARAATGAASSARSAFQAGSASAGGGLRGTAAGVGNVAKTGAQ
AAGQKVAEGARSMREHVAAAFRPDDAGSASGAGAAQAANEPTPSTAQPAWAKRLHRRQQL
THAATTAAHTLRGGDGGSSSQGPSLRDSDS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgtgacggtcatcgaccgcttcctcgacaccttctcgcgctacatcgactcg
ggctttggcctgttgcacggcgaagtggcgtttctgaccgccacgctgatcgtcatcgac
atgacgctcgccgggctgttctgggcgatgagccatgccaccggccagggcgaggacgtg
atcgccaagctgatccgcaaggtgctgtacgtcggcgccttcgcctacatcatcggcaac
ttcaactggttggtcggcatcgtgttccgctccttcgccgggctgggcctgacggccagc
ggctcgaccttgagcatggagaacttcctgcaaccgggccggctggcgaaggtcggcatc
gacgccggggcgccgatcctgaaacagatcggcgacatggcgggctttcccgaagtgttc
gtgaacatcacgcccatcgtcgtgatgttcctcgcgtggctgatcgtcctgctgtgcttc
ttcgtgctggcgatccagcttttcatcacgctgatcgagttcaagctaacaacgctcgcg
ggcttcgtgctggtgccgttcgcgctgtggaacaagacggcgttcctggccgagaaggta
cttggcaacgtggtgtcgtcaggcatcaaggtgctggtgctcgcggtcatcgtcggcatc
ggctccgggctgttcgccgagtttcaggtgcagccggccgagccatccatcgaccactcc
gtggtcgtgatgctggcctcgctgaccctgttggcgctgggcatcttcgggccgggcatt
gcgaccgggctggtgtccggcgggccgcagctcggcgcgggtgcgatggccggtgccgct
ctgggtgcggccggtgctgctgttgccgtgggcgccgcagccacgggcgtcggcggtgca
gtcgccgccggggcgcgcatggcgcccgcagccgccaggctggcgggcagcggagcgcgg
gccgccaccggagccgccagcagcgcacggtcagcgtttcaggcgggttctgcatccgct
ggcggtggcctcaggggcacagccgccggcgtgggcaatgtcgccaagaccggcgcacag
gcggccgggcagaaggtggccgaaggcgcgcgctcgatgagggagcatgtcgctgctgcc
ttccggcccgacgacgccggatcggcttcgggggccggcgccgcgcaggcggcaaacgag
ccaaccccatccactgcgcaacccgcctgggccaagcgtctgcatcgcagacagcagctc
acccatgccgcgacgactgccgcccacacgctgcgcggcggcgatggcggtagttccagc
caggggccaagccttcgtgattccgattcctga

DBGET integrated database retrieval system