KEGG   Acidovorax ebreus: Dtpsy_3502
Entry
Dtpsy_3502        CDS       T00853                                 

Definition
(GenBank) P-type conjugative transfer protein TrbJ
  KO
K20266  type IV secretion system protein TrbJ
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_3502
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3502
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_3502
SSDB
Motif
Pfam: DUF948 Spc7 DUF2452
Other DBs
NCBI-ProteinID: ACM34927
UniProt: B9MII9
Position
complement(3752115..3752870)
AA seq 251 aa
MKLHTPKLAALTAACVLAFGIAQPAHALFGVGDIVLDPTNLVQNTLTAVRTLEQINNQIR
QLQNEAQMLINQARNLASLPSSVVGQLRENLATTQRLIAQAKGLAYDVTSIDREFARLYP
EKYAATVSGNQMYLDAQERWKNTLNGLQTTMQMQAQASQNLSDDESVLADLVGKSQSAEG
ALQAMQAMNQLLALQAKQSIQTQRLQITQDRAASLELARQAAATERGREVTRRFLGEGTP
YTPQPVNFYNR
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaaattgcatacccccaaactcgccgcgctgaccgctgcctgcgtgctcgccttcggc
atcgcacagcctgcgcacgcgctgttcggcgtcggcgacatcgtgctcgatccgaccaat
ctggtgcaaaacacgctcacggcggttcgcacactggagcagataaataaccagatccgc
cagctccagaacgaagcgcaaatgctcatcaaccaggcgcgcaatctggccagcctgccg
tccagtgtggtcggccagttgcgcgagaacctggcgaccacccagcgactgatcgcgcag
gccaagggcttggcctacgacgtgacaagcatcgaccgcgaattcgcgcgtctgtacccc
gagaagtacgccgccacggtgagcggcaatcagatgtacctcgatgcgcaggagcgttgg
aagaacacgctcaacggcctgcaaaccaccatgcagatgcaggcccaggcgtcgcagaac
ctgagcgatgacgaaagcgtgctggccgacctcgtgggcaagagccagtcggccgagggc
gcgctgcaagcgatgcaggccatgaaccaattgctggccttgcaggccaagcagtccatc
cagacgcagcggctccagatcacgcaagaccgcgcggcctcgctggaactagctcggcaa
gcggcggccacggagcgcggacgcgaggtgacgcgccgtttcctgggtgaaggcacgccg
tacacgccgcagcccgtcaatttctacaaccgctga

DBGET integrated database retrieval system