KEGG   Acidovorax ebreus: Dtpsy_3503
Entry
Dtpsy_3503        CDS       T00853                                 
Name
(GenBank) CagE TrbE VirB component of type IV transporter system
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dia00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_3503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3503
Enzymes [BR:dia01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Dtpsy_3503
Secretion system [BR:dia02044]
 Type IV secretion system
  Trb secretion system protein
   Dtpsy_3503
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 HerA_C AAA_22 TraG-D_C AAA_16 Zot AAA_29 CbiA
Other DBs
NCBI-ProteinID: ACM34928
Position
complement(3752867..3755338)
AA seq 823 aa
MLNLAEYRQRPALLADWLPWAGLVAPGVVLNKDGSFQRTARFRGPDLDSATQGELIATSA
RLNNALRRLGSGWALFIEAERRSAADYPHSDFPEPLSWLVDEERRAAFEDSGNHFESGYH
LTLAYLPSEESRARAAGLLYENRPTEGVDWRERLHAFVAETDRIFDLLDGVMPEIAWLDD
SQTLTYLHSTISTRRYRVGVPEVPFHIDALLTDSALVGGLAPMLGDQHLRVVSVRGFPTS
TWPGILDDLNRLGFAYRWSTRFLCLDKAEAEKELARLRRQWFAKRKNVIALLRETIFQQE
SPLVDTDANNKAADADAALQELGSDQVAFGYLTATVTVMDADAAVADEKLRMVERVIQGR
GFVTIPEALNAVDAWLSSLPGNAYANVRQPIVSTLNLAHMMPVSAVWAGPEKNDHLDGPP
LIVTRTDGATPFRLVTHIGDVGNTLVVGPIGMGKSVLLATMAMQFRRYRGSRIFAFDMGR
SIRAAILGMGGEHYDLGADDEIAFQPLARIDREGYRTWASEWVEGRLLHEGAAVGPDEKA
AIWSALGSLASAPVEQRTLTGLTALLQSNTLRQALAPYVLGGAHGRLLDADHDRLGTADV
QAFEMEELMHSKAAVLAVLRYLFARFEERLDGAPTLLILDEAWLFLDDPVFAARIRQWLK
TLRKKNVSVIFATQSLADVKDSAIAPAIIESCASRIFLPNPQATEPQIRTIYEGFGLNSR
QIEIVATAQPKRDYYYQSRLGNRVFDLDLGPATLAFAGASTPQDQRAIDEVLGRVPQDAG
VSGFAGAWLRHRGLDWAADLLPSFPGLAPGSLRTADHPQENQP
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgctgaacctcgccgaataccgccagcgcccggccttgctcgccgactggctgccctgg
gccgggctggtggcgccgggcgtcgtcttgaacaaggacggcagtttccagcgcacggcg
cgctttcgtggccccgacctcgacagcgcgacgcagggcgagctgatcgccacgtcggcg
cgcttgaacaacgcgctgcgtcgcctgggttcgggttgggcgctgttcatcgaagccgag
cgccggtctgccgccgactacccgcactccgatttccccgaaccgctgtcctggctggtc
gatgaagaacgccgcgccgccttcgaggattcgggcaaccacttcgagagcggctatcac
ctgacgctggcctacctgccgtccgaggaatcccgtgcccgcgccgcgggcctgctgtat
gaaaaccggccgaccgaaggcgtggattggcgcgaacggctgcacgccttcgtcgctgaa
acggatcgcatcttcgacctgctcgatggcgtgatgccggagatcgcatggcttgatgac
agccagacgttgacctacctgcattcgaccatctcgacgcgccgctaccgcgtcggcgtt
cccgaagtgccgttccacatcgacgcgctgctgacggactccgcactggtcggcggcctg
gcgcccatgctgggtgaccagcacctgcgcgtggtgtcggtgcgcggtttcccgacttcg
acctggccggggattctggacgacctcaaccgcctgggcttcgcgtatcgctggagtacg
cgctttctgtgcctcgacaaagccgaggcggaaaaagaactcgcccgcctgcgccgccag
tggtttgcgaaaaggaagaacgtcatcgcgctgctgcgcgagacgatcttccagcaggaa
agcccgctggtcgataccgacgccaacaacaaggccgccgacgccgatgctgccttgcag
gaactgggcagcgatcaagtcgccttcggctacctgacggcgaccgtcaccgtcatggac
gcggacgccgccgtggccgacgagaagctgcggatggtggagcgtgtgattcagggccgg
ggtttcgtgacgatccccgaagcgctcaacgccgtggatgcgtggctgtcctcgctcccc
ggcaatgcatacgccaacgtgcgccagcccatcgtctcgacgctgaatctggcgcacatg
atgccggtgtcggcggtatgggccgggccggagaagaacgatcacctcgacggcccgccg
ctgatcgtgacgcgcaccgatggcgccacgccgttccgactggtgacgcacatcggcgac
gtgggcaacactctggtggttggccccatcggcatgggcaagtcggtgctgctggcgacg
atggcgatgcagttccgccgctatcgcggctcgcgcatcttcgccttcgacatggggcgc
tcgatccgtgcggccatcctgggaatgggcggcgagcactacgacctgggcgcggatgac
gagatcgccttccagccgctggctcgcatcgaccgcgagggctaccgcacctgggccagc
gaatgggtggaaggccgcctgctgcacgaaggcgcggccgtcggccccgacgagaaggcg
gccatctggtctgcgttggggagcctggccagcgcgccggtggagcagcgcacgctcacg
ggcctgacggccttgctgcaatcgaataccttgcgccaggcactcgcgccctacgtcctg
ggcggtgcgcacggcaggctgctggatgccgaccacgaccgcctcggcacggccgacgtg
caggcgttcgagatggaggagctgatgcacagcaaggccgctgtgctcgcggtgctgcgc
tatctgttcgcgcgcttcgaggagcggctggatggtgcgcccacgttgctgatccttgat
gaagcgtggctgttcctcgatgacccggtattcgcggcgcgcatccgccagtggctcaag
acgctgcgcaagaagaacgtcagcgtcatcttcgctacgcagtcgctcgcggacgtgaag
gactcggccatcgcacccgcaatcatcgaaagctgcgcgagtcggattttcttgccgaac
ccgcaagcgaccgaaccgcagattcgcacgatctacgaaggcttcggcctcaacagccga
cagatcgagattgtcgccaccgcgcagcccaagcgcgactactactaccaatcccgcctc
ggcaaccgcgtgttcgacctcgacctggggccggcgacgctggccttcgcgggcgcttcc
acgccgcaagaccagcgcgccattgatgaggttcttggccgcgtgccgcaggacgctggc
gtgtccggcttcgcgggcgcctggctgcgccatcgcggcctcgattgggcggctgacctg
ctgccctcgttccccggcctcgcgccgggttccctccgtaccgctgaccacccccaggag
aaccaaccatga

DBGET integrated database retrieval system