KEGG   Acidovorax ebreus: Dtpsy_3510Help
Entry
Dtpsy_3510        CDS       T00853                                 

Definition
(GenBank) transcriptional regulator, LysR family
Organism
dia  Acidovorax ebreus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1 MarR_2 TetR_C_22 LOH1CR12 HTH_24
Motif
Other DBs
NCBI-ProteinID: ACM34935
UniProt: B9MIJ7
Position
complement(3759969..3760883)
Genome map
AA seq 304 aa AA seqDB search
MELRHLRCFIAVAEELHFARAAERLHIDQSPLSRTIKELEEELGARLFVRTTRSTQLTHA
GRLFLEHVQRVFAALDQARDSVKSVANGFHGQLRLALSDGITPSRLPALLAQCREEDPEV
EVRLFEVPLAQQIKGLHDNLYDAGFSMADDGGDGIAVSSAWEDELMVAVPARHPVLAFKQ
VPLKEVLRYPLALGDPAVCEGHARQVDRFLRKLDQEPLIAQRVATFDVMMTLVSAGLALG
LAGEAHIASSREPGVVARRLAGKPYMLTTYLLRRDAEPSEMLARFIERVAFIDSADCIDA
ADDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggagttgcgccatttacgctgcttcatcgccgtcgccgaagaactccactttgctcgt
gctgccgagcggctgcacatcgaccagtcaccgctgtctcgcaccatcaaagagttggag
gaagaacttggcgcacgtctgtttgtccgtaccacccgcagcacgcaattgactcatgct
ggacggctgttcctggaacacgtccagcgcgtttttgcggcattggatcaagcccgagat
agcgtcaagtccgttgccaacggctttcacgggcagttgcgccttgccctgtccgacggg
atcacgccatcgcgcctgccggcgctattggcgcaatgtcgggaggaagaccccgaagtc
gaagttcggctgttcgaggttccgctggctcagcagattaaggggttgcacgacaacctg
tacgacgccggcttctcgatggccgatgatggaggcgatggcattgcggtcagttccgcg
tgggaggacgagttgatggtggcggtgccagcccgccatcccgtgctcgctttcaaacag
gtcccactgaaagaagtgctgcgctacccactggcgctgggcgacccggcggtctgcgaa
ggccacgcgcggcaagtcgatcgttttctgcgcaagctcgatcaggaaccgctgatcgcg
cagcgcgtggcgaccttcgacgtgatgatgaccctggtttccgctggcctggctttgggt
ttagcgggcgaggcgcatatcgcttccagccgtgagccgggcgtcgtggcccgccgcctg
gcaggcaagccatacatgctcacgacctatctgctacgccgcgatgcggagccatccgag
atgctggctcggttcatcgagcgtgtggccttcattgattcggcagactgtatcgacgct
gccgacgatgcttga

DBGET integrated database retrieval system