KEGG   Acidovorax ebreus: Dtpsy_3542
Entry
Dtpsy_3542        CDS       T00853                                 

Definition
(GenBank) YidC translocase/secretase
  KO
K03217  YidC/Oxa1 family membrane protein insertase
Organism
dia  Acidovorax ebreus
Pathway
dia02024  Quorum sensing
dia03060  Protein export
dia03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:dia00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    Dtpsy_3542
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Dtpsy_3542
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Dtpsy_3542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dia03029]
    Dtpsy_3542
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dia02044]
    Dtpsy_3542
Mitochondrial biogenesis [BR:dia03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    Dtpsy_3542
Secretion system [BR:dia02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   Dtpsy_3542
SSDB
Motif
Pfam: YidC_periplas 60KD_IMP DUF2427
Other DBs
NCBI-ProteinID: ACM34965
UniProt: B9MIZ9
Position
complement(3793633..3795342)
AA seq 569 aa
MNDIRRTILWVIFGFSMVLLWDKWQIHNGNKATFFPTPPAQTASTPAVAASGAGAADVPV
AAASATPGAAPQPPAGASVPPAAIPRERVTVSTDVLRLSFDSEGGSLVHGELLQYPEMED
KTKPFLLLDESASRVYVAQTGLIGNGAGGAFPTHKTPMAVVPGPRELQDGQNELTVRFES
ADMGGVKLVKTWTLKRGAYDVAVKHEVVNTGTAPVSPQLYLQLARDGNKPAGESSFYSTF
TGPAVYTEAKKYHKVEFKDIENGKAEIDKSSSNGYVAMVQHYFATAWLLGDGVQRDNFVR
KVDTNLYSVGMITPLGEIAPGQSKAVDARLFAGPQIETLLEKLAPGLELVKDYGWLTILA
KPLYWLLDQLHKVLGNWGWSIVALVFLLKIAFYWLNAKAYASMAKMKAINPRIMEMRERL
KDKPQQMQQEMMRIYREEKVNPMGGCLPIMIQIPVFIALYWVLLSSVEMRNAPWIGWIKD
LSSPDPFFILPLLMTLSSLLQTALNPAPPDPMQAKMMWLMPLMFSVMFFFFPAGLVLYWL
TNNILSIAQQWIINTRMGVPPQFNLPKFR
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgaacgacatccgccgcaccatcctgtgggtgatctttggcttttccatggttctgctg
tgggacaagtggcagatccacaacggcaacaaggccaccttcttccccacgccgccggcg
cagacggccagcacgcccgcggtagcggcctccggcgctggcgctgccgacgtgccggtg
gccgccgccagcgccacgccgggcgcggcgccgcagccgcccgcaggcgccagcgtgccg
cctgccgccatcccgcgcgagcgggtgaccgtgagcaccgacgtgctgcgcctgagcttt
gactccgaaggcggttcgctggtccacggagagctgctgcaatatcccgagatggaggac
aagaccaagcccttcctgctgctggacgagagcgcttcgcgtgtttatgtcgcgcagacg
ggcctcatcggcaacggtgccggcggcgccttccccacgcacaagacccccatggcggtc
gtgcccggtccgcgcgaactgcaggacggccagaacgagctgaccgtgcgtttcgagtcg
gccgacatgggcggcgtgaagctggtcaagacctggacgctcaagcgcggcgcctacgac
gtggccgtgaagcatgaggtggtcaacacgggcacggccccggtatcgccccagctgtac
ctgcagttggcgcgcgatggcaacaagccggcgggcgagtcgtcgttctactccacgttc
accggtccggccgtgtacaccgaggcgaagaagtaccacaaggtggagttcaaggacatc
gagaacggcaaggccgagatcgacaagtcttccagcaacggctacgtggccatggtgcag
cactacttcgccaccgcgtggctgctgggcgacggcgtgcagcgcgacaacttcgtgcgc
aaggtggacaccaacctgtactcggtgggcatgatcacaccgctgggcgagatcgccccc
ggccagtcgaaggccgtggacgcgcgcctgttcgccggcccgcagatcgagacgctgctg
gaaaagctggccccgggcctggagctggtcaaggactatggctggctgaccatcctggcc
aagccgctgtactggctgctggaccagttgcacaaggtgctgggcaactggggctggtcc
atcgtggcgctggtgttcctgttgaagatcgcgttctactggctcaacgccaaggcctac
gccagcatggccaagatgaaggccatcaacccgcgcatcatggaaatgcgcgagcgcctg
aaggacaagccccagcagatgcagcaggagatgatgcgcatctaccgcgaggagaaggtc
aaccccatgggcggctgcctgcccatcatgatccagatcccggtgttcatcgcgctgtac
tgggtgctgctgtccagcgtggagatgcgcaatgcgccgtggatcggctggatcaaggac
ctgtcctcgcccgacccgttcttcatcctgccgctcctgatgacgctctcgtcgctgctg
cagaccgcgctgaaccccgcgccgccggacccgatgcaggccaagatgatgtggctgatg
ccgctgatgttcagcgtgatgttcttcttcttcccggccggcctggtgctgtactggctg
acgaacaacatcctgtcgatcgcgcagcagtggatcatcaacacccgcatgggcgtgccg
ccgcagttcaacctgcccaagttccgctga

DBGET integrated database retrieval system