KEGG   Desulfurispirillum indicum: Selin_0297Help
Entry
Selin_0297        CDS       T01383                                 

Definition
(GenBank) phosphatidylserine decarboxylase related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
din  Desulfurispirillum indicum
Pathway
din00564  Glycerophospholipid metabolism
din01100  Metabolic pathways
din01110  Biosynthesis of secondary metabolites
Module
din_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:din00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Selin_0297
Enzymes [BR:din01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Selin_0297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ADU65053
UniProt: E6W6Q3
Position
complement(334441..335091)
Genome map
AA seq 216 aa AA seqDB search
MRKPLYGVAREGYPLILPPIVLGLLLLGLGFTFTPAILLFIGFFCLFFFRDPERRGDFSP
SQLVSPADGKVIVVKEHDHGPIEGQRVVQISIFLNIFNVHVNRSPVFGTIVDAQYKPGRF
HAADKDIAALENEHTLVTVDVTNGPRICFKQIAGLVARRVVFWGKKGDQLEAGMRIGLMK
FSSRMDLFIPADKISLQVQEGQKVRAGITILGEFRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgctatatggtgttgcccgcgaaggctatccgctgattctccctcccatc
gtcctcgggcttctgctgctgggactcggctttacatttactccggcaattctgctgttt
atcgggtttttctgccttttcttcttccgcgatccggagcgtcggggcgacttctccccc
tcccagctcgtctcgcccgcagacggcaaggtcattgtcgtcaaggagcacgaccacggg
cccatcgaagggcagcgggtggtacagatatccattttcctgaatatcttcaatgtgcat
gtcaaccgttcgccggtcttcggaaccatcgtggacgcccaatacaagcctggccgcttc
cacgccgccgacaaggacatcgccgccctggagaacgagcataccctggttacggtggat
gtcaccaacgggccgcgcatctgtttcaagcagattgccggactggtggcacgccgggtg
gtcttctggggaaaaaaaggcgatcagcttgaagccggcatgcgcattggccttatgaag
ttcagctcccgcatggatctgtttatcccggccgacaaaatctccctgcaggtgcaggag
ggacagaaagtacgcgcgggaataaccatactgggagaattccgtgcataa

DBGET integrated database retrieval system