KEGG   Desulfurispirillum indicum: Selin_1134Help
Entry
Selin_1134        CDS       T01383                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
din  Desulfurispirillum indicum
Pathway
din03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:din00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Selin_1134
Enzymes [BR:din01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Selin_1134
DNA repair and recombination proteins [BR:din03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Selin_1134
    RecFOR pathway proteins
     Selin_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HHH_5 RuvA_N RuvA_C HHH HHH_8 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ADU65869
UniProt: E6W401
Position
complement(1247614..1248222)
Genome map
AA seq 202 aa AA seqDB search
MISLVSGTVHSLTQDRATILTSGGVGYELSIPASLATSLKVDQTVSIQTWMGVKEDAITL
YGFSSSEEKALFLLLMKVSGIGAKIALAAVGTLNTQQLGNAIAMGDIATIQRIPGVGKKV
AEKIALELKDKVTPAAATSSAPQAFTGTTSGTPSVFADAVQGLIALGLRREEADSAARRA
MAAGADSETSIIREVLRQRGHQ
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatttccctcgtcagcggcacggtacacagcctcacccaggatcgcgccaccatactg
acctccggtggagtcggctacgaactctccatccccgcctccctggccacctcgctgaag
gtggatcagacggtgagcattcagacctggatgggcgtcaaagaagatgccatcaccctg
tatggattcagcagcagtgaagagaaagccctcttcctgctcctcatgaaagtctccggc
atcggagcgaagattgccctggccgcagtgggcaccctgaacacgcaacagctgggcaac
gccatcgccatgggcgacatcgccacgattcagcgtattcccggtgtgggcaagaaagtg
gctgaaaagatcgccctggaactcaaggacaaggtcactcccgctgccgccaccagcagc
gcgccccaggcctttaccggcaccacttccgggacaccatcggtctttgccgatgcggta
cagggcctgatcgccctgggactgcgccgcgaagaagccgacagcgccgcgcgccgcgcc
atggcagccggagccgacagtgaaacctctattatccgtgaagtactcagacagcggggc
catcaatga

DBGET integrated database retrieval system