KEGG   Desulfurispirillum indicum: Selin_1163Help
Entry
Selin_1163        CDS       T01383                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
din  Desulfurispirillum indicum
Pathway
din00330  Arginine and proline metabolism
din00332  Carbapenem biosynthesis
din01100  Metabolic pathways
din01130  Biosynthesis of antibiotics
din01230  Biosynthesis of amino acids
Module
din_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Selin_1163
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Selin_1163
Enzymes [BR:din01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Selin_1163
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADU65898
UniProt: E6W4C4
Position
1278319..1279455
Genome map
AA seq 378 aa AA seqDB search
MSASSLVQVIQEAQCIVIKVGSNVLVRGTGLDLPFLYTLAEDIHELRQAGKKVVIVTSGS
IATAMVKLATPARPKALPLKQAYAAVGQLGLMWEYERAFRVYNIPVAQVLLTRGDLENRK
RYLNSHNTFMALFDLGVIPIVNENDTVATDEIRFGDNDSLSAMVAGVVNADVNIILSDID
GLYTANPQLEPGATHIALVTSIDEQVEKMAGNSLSSVGTGGMITKMQAAKICMNAGIHMI
IGCGRGNHALRRLMKGKTRGTLFEPSIDAVSAKKRWILQSLTSKGKLVIDDGARQALTRK
DASLLPIGVTGVQGRFERGDCVDIVGADGVAVAKGLALYSSDEIVRIKGKKSTEIEQVLG
YTNHDDLVHRDNMVLYNA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaagttcgctcgttcaggtcatccaggaggctcagtgtattgtcatcaaggta
ggcagcaacgtgctggtgcgtggcaccggccttgacctgcccttcctgtacacactggcg
gaggatattcacgaactgcgccaggccggaaaaaaagtggtcattgtcacctcgggctcc
attgccacggccatggtcaaactcgccactcccgcccggcccaaggcccttcccctgaag
caggcctacgccgctgtcgggcagctggggctgatgtgggagtatgaacgggcatttcgc
gtctataatattcctgtagcccaggtgctgctgaccaggggtgatctggaaaaccgcaaa
cggtatctcaattcccacaatacctttatggcgctctttgatctgggtgtcattcccata
gtcaatgaaaatgacaccgtggccaccgatgaaatccgtttcggtgacaatgactctctc
tcggccatggttgccggggtggtgaacgccgatgtcaatattatcctcagtgatatcgat
ggcctctatactgccaacccacagcttgaacccggcgccacgcacattgcgctggtgacc
agtattgatgagcaggtggagaagatggcgggtaacagcctctccagtgtcggtactggt
ggcatgatcaccaaaatgcaggcggcgaaaatctgcatgaatgccggcattcacatgatt
atcggctgtggcagaggcaaccacgctctgcggcgtctgatgaaggggaagacccggggg
acgctctttgagccttccattgacgcggtctccgctaaaaaacgctggatactgcagtcc
ctcaccagcaagggaaagctggttatcgatgacggagccaggcaggcgctgacccgcaag
gacgccagcctgctgcccatcggggtgacaggggtgcaggggcgctttgagcgtggagac
tgtgtggacattgtaggcgcagatggcgtggcagttgccaagggcctggccctttacagt
tccgatgagatcgtccgtatcaaagggaaaaaatctactgaaatagagcaggttttaggg
tataccaatcacgatgacctcgttcaccgcgacaacatggtcctttacaatgcgtaa

DBGET integrated database retrieval system