KEGG   Desulfurispirillum indicum: Selin_2325Help
Entry
Selin_2325        CDS       T01383                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
din  Desulfurispirillum indicum
Pathway
din00790  Folate biosynthesis
din01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:din00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Selin_2325
Enzymes [BR:din01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Selin_2325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADU67041
UniProt: E6W477
Position
2562996..2563823
Genome map
AA seq 275 aa AA seqDB search
MNLCAPWPKIAGILNVTPDSFSDGGCHLQTRNAVERGLQMVVEGAHIIDVGGESTRPGAA
RVSAEEQMKRILPVIDALVAHEVPISVDTTSALVARVCIDRGATMINDISAGKDDPAMFP
LAVEREVDICLMHKRGNPAVMQQLTHYDDVVDEVHHYLAMRAQAFLEAGGSAGRLFLDPG
IGLPKDSQANLRLIMSMGRLRQLGYQTYLGASRKSFIGAICQVEDPRERLPGSLVVAMEA
YRQGVHMLRVHDVAATVQALKMAAALWAHTDNNKL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaacctctgcgccccctggccgaaaattgcgggcatcctcaatgtcacccccgactct
ttcagcgatggcgggtgccacctgcagaccaggaatgccgtggagcgcggtctgcagatg
gtggtggagggggcgcacatcattgatgtgggtggcgagtcaacccggccgggagcggcc
agagtcagtgccgaagagcagatgaagcgcattctgccggtgatcgatgccctggtcgcc
cacgaggtgccgatcagcgtggatacgaccagcgcactggtggccagagtctgcattgat
cgtggtgccaccatgatcaatgatatcagcgccggaaaagatgacccggccatgttcccc
ctggcagtggaacgcgaagttgacatctgcctcatgcacaagcggggcaacccggctgtc
atgcagcagctgacacactatgacgatgtggttgacgaggttcaccactacctggcgatg
cgggcacaggcattccttgaggcgggtggcagcgccggacgccttttcctggaccccggc
atcggcttacccaaggacagccaggccaatctccggctcatcatgtccatgggcaggctg
cggcagctgggctaccagacctacctgggagccagccgcaagagcttcatcggcgcgata
tgccaggtggaagacccccgggagcgcctgcccggcagcctggtggtcgccatggaggca
tatcggcagggggtgcacatgctgcgggttcatgacgttgcggcgactgtccaggccctg
aagatggcggcggcactgtgggcacatacagataacaacaagctctga

DBGET integrated database retrieval system