KEGG   Dietzia sp. oral taxon 368: C3V38_11120Help
Entry
C3V38_11120       CDS       T05390                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
dit  Dietzia sp. oral taxon 368
Pathway
dit00030  Pentose phosphate pathway
dit00480  Glutathione metabolism
dit01100  Metabolic pathways
dit01110  Biosynthesis of secondary metabolites
dit01120  Microbial metabolism in diverse environments
dit01130  Biosynthesis of antibiotics
dit01200  Carbon metabolism
Module
dit_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
dit_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:dit00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    C3V38_11120
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3V38_11120
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dit04147]
    C3V38_11120
Enzymes [BR:dit01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     C3V38_11120
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     C3V38_11120
Exosome [BR:dit04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   C3V38_11120
  Exosomal proteins of colorectal cancer cells
   C3V38_11120
  Exosomal proteins of bladder cancer cells
   C3V38_11120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AVM64835
UniProt: A0A2S0LX66
Position
2379359..2380753
Genome map
AA seq 464 aa AA seqDB search
MPTTTSQNDRPTLAILGAGGDLTERLLLPGLGSLLARDPGRDVTVVGSGRSGMDDDEWRG
LVRSALREGGCGPDQADRIAATTRFVALDVTDADAFADFIDGLDGPVVLYFALPPAVTAT
ACEGLRGRPLRDDVRFAVEKPFGTDLASARDLNALLLDLVPEDRVHRVDHFLGDANVLNI
LGMRFGNRVLEPVWTAEHVERIDVVADETLALEGRAGYYDSTGALVDMLQSHLLLVTALV
TMEAPARLDATELHDLLATTLRSTHVWRDDPSACSRRARYTAGRAGGRDVVAYTDEEGVD
PSRGTETLAEVVLEVRNQRWAGVPVRLRSGKALGEDSMRVTVTFRPPPHVPEAFAGGAPP
SRLTMGIAPGRVALDLATNASGDSLALEDSHLDTELGDSDLLPYGEVLGRILDGDRLLTV
RGDVAEECWRILTPVIEAWESGAVPMEEYEAGSDGPVEGNPGTT
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccaccacgtcacagaacgaccgccccaccctggcgatcctgggggccgggggt
gatctcaccgagcgcctcctgctccccggcctgggttcgctcctggcgcgcgaccccggg
cgggacgtcaccgtcgtcggctccggccgatccggtatggacgacgacgagtggcgcgga
ctcgtccggtcagcgctgcgcgagggcggctgcggaccggaccaggccgaccggatcgcg
gcgacgactcgcttcgtcgccctggacgtcacggacgccgacgcgttcgccgacttcatc
gacgggctcgacggcccggtggtgctgtacttcgccctgcccccggccgtcaccgccacg
gcgtgcgagggactgcgcggccgcccactccgcgacgacgtacggttcgcggtcgagaag
ccgttcggcaccgacctcgcctcggcccgagacctcaacgcgctgctcctcgacctcgtc
cccgaggaccgcgtccaccgcgtcgaccacttcctcggcgacgcgaacgtcctcaacatc
ctcgggatgcggttcggtaaccgggtcctggaacccgtgtggacagccgagcacgtcgag
cgcatcgacgtcgtggccgacgagaccctcgccctcgagggccgtgccggctactacgac
tcgaccggtgcgctggtcgacatgctccagtcgcacctgttgctcgtgacggcgctggtc
accatggaggcgcccgcgcgactcgacgccaccgaactgcacgacctgctcgccaccacc
ctccggtccacccacgtgtggcgggacgacccgtccgcgtgctctcgtcgcgcccgctac
acggccggcagggcgggcggccgtgacgtcgtcgcctacaccgacgaggagggcgtcgat
ccgtcgcgggggaccgagacgctcgccgaggtggtgctcgaggtccggaaccagcgctgg
gcgggagtgcccgtgcggctccggtcaggcaaggcactgggtgaggactcgatgcgggtg
acggtgacgttccggccgccgccacacgttccggaggcgttcgcgggcggggccccgccg
agccggctcacgatgggcatcgcgcccggccgggtggcactcgacctggcgaccaacgcc
tccggcgacagtctcgcgctcgaggactcccacctcgacaccgagctcggcgacagcgac
ctgctcccgtacggggaggtcctcgggcggatcctcgacggggaccggctcctcaccgtc
cgcggcgacgtcgccgaggagtgctggcggatcctcaccccggtgatcgaggcctgggag
tccggcgcggtcccaatggaggagtacgaggcgggctcggacggcccggtcgaggggaac
cccgggacgacgtag

DBGET integrated database retrieval system