KEGG   Dietzia sp. JS16-p6b: CT688_02415Help
Entry
CT688_02415       CDS       T05397                                 

Definition
(GenBank) acyl-CoA oxidase
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz00071  Fatty acid degradation
diz00592  alpha-Linolenic acid metabolism
diz01040  Biosynthesis of unsaturated fatty acids
diz01100  Metabolic pathways
diz01110  Biosynthesis of secondary metabolites
diz01212  Fatty acid metabolism
Module
diz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:diz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CT688_02415
   00592 alpha-Linolenic acid metabolism
    CT688_02415
   01040 Biosynthesis of unsaturated fatty acids
    CT688_02415
Enzymes [BR:diz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     CT688_02415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AVZ38513
UniProt: A0A2S0QBU3
Position
complement(536956..539037)
Genome map
AA seq 693 aa AA seqDB search
MTSETDVQNAAAPGAAAPQPASAGHPHYGRITTTGQGDPALAAGLQKVLDGRWADARRMT
REAMTPDMLNPIGATMEEHRARVLEQMRLLADSGLPGLGFRTEDGGTGDTGGALTSFEML
GHLDLSLMVKAGVQWGLFGGAIANLGNAETRSTYLPDVMSLDLMGCFAMTELGGGSDVQN
LETTATFDRETGEFVVHSPTPSSEKWYIGNAARDGSMAAVFAQLITHDEEGEEVHHGVHC
LLVPIRDEDGNDLPGVTTTDHGHKGGLLGVDNGKIMFDHVRVPREALLDRFGAVDAEGRY
SSPIDSVGARFFTMLGTLIRGRVSVGAAAGATARTALALAVRYSLIRRQFDHPETGKGIP
LLEYREHQRRLMPRIARAYAYACAQNAIVADLHDFEKNPDAFDAERRREMESHAAGIKAT
VTGFANDTIIEARLACGGAGYMSENLLTEMRKDCDVFSTFEGDNVVLTQLVAKELLGAYA
AEFGDMDQRETVAFALTTAVDVVQEKARASTLWQKLIDTVTDRENTDLLDRANQLELLVD
REEHLLETVARRLRKAQGEDGSAAFKVFNSAQDHMLQAGRAHMDSWVFARFAEAVDACED
PQAKEVLGTLCDLYVLDIVDRDKGWFLEHNRLTTERTKAATAARNRLCTKLAGKARTLVD
AFAIPEFVFDVPMLTDGGVDAPLETTSGAGERD
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgacctccgagaccgacgtccagaacgccgcggcccccggcgcggcggccccccagccg
gccagcgcggggcacccccactacggccgcatcaccacgaccggccagggggaccccgcc
ctcgccgcaggactccagaaggttctggacggtcgctgggcggacgcgcgccggatgacg
cgagaggccatgacccccgacatgctcaacccgatcggggcgacgatggaggagcacagg
gcgcgggtgctcgagcagatgaggctcctcgccgactcgggtctgcccgggttggggttc
cgcaccgaggacggcggaacgggtgacaccggcggggcgctgacctccttcgagatgctc
ggtcacctcgacctgtcgctcatggtcaaggccggcgtgcagtggggcctgttcggcggg
gccatcgcgaacctcgggaacgccgagacccgctccacgtacctgccggacgtcatgtcg
ctggacctgatggggtgcttcgccatgaccgagctcggtggcggttcggacgtgcagaac
ctcgagaccaccgcgaccttcgaccgcgagacgggcgagttcgtcgtccactcccccact
ccgagctcggagaagtggtacatcgggaacgccgcccgtgacggttccatggccgccgtc
ttcgcccagctcatcacgcatgacgaggagggtgaggaggttcaccacggggtccactgc
ctgctggtgccgatccgggacgaggacgggaacgacctgccgggcgtcaccaccaccgac
cacggccacaagggcggcctgctgggcgtggacaacggcaagatcatgttcgaccacgtc
cgggtgccccgcgaggcgctcctcgaccggttcggcgccgtggacgccgagggtcggtac
tcgtcgcccatcgattcggtcggtgcccgcttcttcacgatgctcggaacgctgatccgc
ggccgcgtgtcggtgggtgcggccgccggtgccaccgcccggaccgcgctggccctggcg
gtgcggtactcgctgatccgccgccagttcgaccaccccgagacgggcaaggggatcccg
ctgctggagtaccgcgagcaccagcggcgcctgatgccacggatcgcccgcgcgtacgcc
tacgcgtgcgcccagaacgcgatcgtcgccgacctgcacgacttcgagaagaacccggat
gcgttcgacgccgaacgtcggcgtgagatggagtcccacgccgcgggcatcaaggccacg
gtgacggggttcgccaacgacaccatcatcgaggcccgcctcgcgtgcggcggtgccggg
tacatgtccgagaacctgctcaccgagatgcgcaaggactgcgacgtcttctccacgttc
gagggcgacaacgtggtgctcacgcagttggtggccaaggagctgctcggcgcctacgcc
gcggagttcggggacatggaccagcgcgagaccgtggccttcgcgctcaccaccgcggtg
gacgtggtgcaggagaaggcgcgtgcgtcgacgctgtggcagaagctcatcgacacggtg
acggaccgggagaacaccgacctgctcgaccgcgccaaccagctggagctgctggtcgac
cgggaggagcatctgttggagaccgtcgcacgccgcctgcgcaaggcccagggggaggac
ggttcggcggcgttcaaggtgttcaactcggcgcaggatcacatgctgcaggccggacgc
gcccacatggacagctgggtgttcgcccgcttcgccgaggccgtggacgcctgcgaggac
ccgcaggccaaggaggtcctggggacgctgtgcgatctgtacgtcctggacatcgtggac
cgcgacaagggctggttcctcgagcacaaccgtctgacgaccgagcgcaccaaggccgcg
accgccgcccgcaaccgcctgtgcaccaagctcgcgggcaaggcgcggaccctggtggac
gcgttcgcgatccccgagttcgtcttcgacgtcccgatgctcaccgacggcggggtggac
gccccgctcgagaccacatcgggagccggcgagcgcgactga

DBGET integrated database retrieval system