KEGG   Dietzia sp. JS16-p6b: CT688_03090Help
Entry
CT688_03090       CDS       T05397                                 

Definition
(GenBank) alpha/beta hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz00903  Limonene and pinene degradation
diz00930  Caprolactam degradation
diz01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:diz00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CT688_03090
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    CT688_03090
Enzymes [BR:diz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     CT688_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 COesterase Peptidase_S9 Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: AVZ38617
UniProt: A0A2S0QCR2
Position
complement(682864..683943)
Genome map
AA seq 359 aa AA seqDB search
MSSRRSPHSGAPYDGGLMLPRATRTGTVPVDGRRSAAPEADRPSGRTPTLTGPGEQGTLR
SRGLAGGLRMFVRPALDKMPATDASLGRLRALTSGAGRAAALETTNDWSSDGPVPGLWVG
RKRFFHSDKVIFHIHGGGFTFGSPWSHKALASRMASETGVPVFLPDYRLAPEHPHPAATE
DTLAGWEWLLSMGFRAQDIVVAGDSAGGNLALQLVAALGAEKAAMPAGVVLLSPWVDLDF
TDMTARDRTRKDPFLALGLAELCRRQYAPGVDPDDPAISPINHVPSPDWPPFLIQCGGEE
IFCGGIEKLAERFAEHGVRHEFQLWPHQFHVFQVFHPLVPEAKLAVRDIGSFIRGCLRG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgagttcacggcggtccccgcacagcggcgcgccctacgacgggggcctgatgctgccc
cgcgccacgcggacggggacggtcccggtggacggtcgccgatccgccgccccggaggcg
gaccgaccgtcgggccgcacgccgacgctgacgggccccggcgagcaggggaccctccgc
tcccgcggactcgccggcggcctgaggatgttcgtccgccccgccctggacaagatgccg
gctaccgacgcgtccctcggtcgacttcgcgcgctgacctccggagccggccgggcggcc
gctctcgagaccaccaacgactggtcctcggacggtcccgtgcccgggttgtgggtgggt
cgcaagcggttcttccactcggacaaggtgatcttccatatccacggcggtggcttcacc
ttcggatccccttggtcgcacaaggccctcgcctcgcggatggccagcgagaccggcgtg
ccggtcttcctgcccgactaccggctcgcgcccgagcacccgcaccccgcggccaccgag
gacaccctcgcgggctgggagtggctgctgagcatgggcttccgggcgcaggacatcgtg
gtggccggggattccgccggcggcaacctcgccctgcaactcgtggccgccctcggcgcg
gagaaggccgcgatgccggcgggggtcgtcctgctctcaccgtgggtggatctggacttc
acggacatgaccgcccgcgaccgcacccgcaaggacccgttcctcgccctcggcctggcc
gagctgtgccgacgccagtacgccccgggggtggacccggacgatcccgccatctcgccg
atcaatcacgtcccgtccccggactggccgccgttcctcatccagtgcgggggcgaggag
atcttctgcggggggatcgagaagctcgccgagcggttcgccgaacacggggtccggcac
gagttccagctctggccccaccagttccacgtgttccaggtgttccaccccctcgtcccc
gaggccaagctcgcggtgcgcgacatcgggtcgttcatccgcgggtgcctgcgcggctga

DBGET integrated database retrieval system