KEGG   Dietzia sp. JS16-p6b: CT688_06390Help
Entry
CT688_06390       CDS       T05397                                 

Gene name
metF
Definition
(GenBank) methylenetetrahydrofolate reductase [NAD(P)H]
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
diz  Dietzia sp. JS16-p6b
Pathway
diz00670  One carbon pool by folate
diz01100  Metabolic pathways
diz01120  Microbial metabolism in diverse environments
diz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:diz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    CT688_06390 (metF)
Enzymes [BR:diz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     CT688_06390 (metF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTHFR DeoC
Motif
Other DBs
NCBI-ProteinID: AVZ41116
UniProt: A0A2S0QK41
Position
1413891..1414814
Genome map
AA seq 307 aa AA seqDB search
MDRIASSRTPRVPFSVEFYPPRDEAAEARLWRAASVFSELGAAFVSVTYGAGGSTRDRTV
KVVERVVRETDLVPIAHLTAVGHSIAELREMIQMYADVGVTNILALRGDPPGDPLGDWTP
HPEGLHYAEELVRLIHEVGDLHVGVASFPEGHYRARDLDHDTEILLNKLRAGAEYSITQM
FWDVEHYLRLRDRLESADPEQAVKPVIPGLMPVTSLRQVRRMVELSGCALPDGLSDRLRT
AAGDGPEENRAAVREVGIEFATELCERLIAEGVPCLHFNTLNFSRATHEVLANLSMVPSP
DVVASGV
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggaccgcatcgcctcgtcgcgcacccccagggtgccgttctccgtggagttctaccca
ccccgggacgaggccgcggaggcccgtctgtggcgcgctgcctcggtgttctccgaactg
ggggcggcgttcgtgtccgtcacctacggtgcgggcggctccacccgcgaccggaccgtc
aaggtggtggagagggtggtccgggagaccgacctggtccccatcgcgcacctgacggca
gtgggccattcgatcgccgaactacgcgagatgatccagatgtacgccgacgtgggggtc
accaacatcctcgcgctccggggcgatccccccggtgacccgctcggggactggacgccg
catcccgagggtctgcactacgcggaggagctcgtccgactgatccacgaggtcggtgac
ctccacgtgggcgtcgcctccttccccgagggtcactaccgggcgcgcgacctcgatcac
gacaccgagatcctgctcaacaagctccgcgccggcgccgagtactcgatcactcagatg
ttctgggatgtcgagcactatctgcgcctgcgggatcgactggagtccgcggacccggag
caggccgtcaaaccggtcatccccgggctcatgccggtgacgagcctgcgtcaggtccgc
cgcatggtggagctgtccgggtgcgcactgccggacggactgtccgacaggctgcgtacg
gcggcgggggacggccccgaggagaaccgtgccgcggtgcgtgaggtggggatcgagttc
gccacggaactctgcgagcgcctgatcgccgagggcgtgccgtgcctgcacttcaacacc
ctgaacttctcccgcgccacccacgaggtgctggccaatctctcgatggtcccgtcgccg
gacgtggtggcgagcggggtctga

DBGET integrated database retrieval system