KEGG   Dietzia sp. JS16-p6b: CT688_10525Help
Entry
CT688_10525       CDS       T05397                                 

Gene name
mca
Definition
(GenBank) mycothiol conjugate amidase Mca
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
diz  Dietzia sp. JS16-p6b
Brite
KEGG Orthology (KO) [BR:diz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CT688_10525 (mca)
Enzymes [BR:diz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CT688_10525 (mca)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L
Motif
Other DBs
NCBI-ProteinID: AVZ39834
UniProt: A0A2S0QAT4
Position
complement(2299836..2300759)
Genome map
AA seq 307 aa AA seqDB search
MAGLRLMAVHAHPDDEASKGSATMAKYVAQGVTVLVETCTGGERGSILNPAMDRPDVVAD
LVRVRRREMARAADILGVEHHWLGYEDSGLPEGDPLPPLPPGCFALADDDEVTRSLVARI
REFRPHVMITYDENGGYPHPDHLKVHSASMAAYEAAADPARYPGTGEPWAIAKVYYTHGF
PKSRLELLDEELFARDGVRHFAEFLSRWGDRPDIMERVTTRVECADYFEQRNSALLAHAT
QIDPNGWFFAAPVEMQQRVWPTEEFELAASRVAIPARAEGEYESDLFEGVDPYVPLPVGP
STAKDPR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggccggtctccggctgatggcggtgcacgcccaccccgacgacgaggcgtccaagggc
tccgcgaccatggccaagtacgtggcccagggcgtcaccgtgctggtggagacgtgcacc
ggcggggaacggggcagcatcctcaaccctgcgatggaccgccccgacgtcgtggccgac
ctcgttcgagtgcgacgccgggagatggcccgcgcggccgacatcctcggcgtcgagcac
cactggctgggctacgaggactcgggtctgcccgagggtgacccgttgccgccgttgcct
cccggatgtttcgcccttgccgacgacgacgaggtcacccgctccctggtcgcccggatc
cgggagttccgcccgcacgtgatgatcacctacgacgagaacggcgggtacccgcatcca
gatcacctcaaggtgcactcggcgtcgatggccgcctacgaggccgccgcggaccccgcc
cgctatccggggaccggcgaaccgtgggcgatcgccaaggtctattacacccacggtttc
cccaagagccgcctggaactgctcgacgaggagttgttcgcgcgcgacggcgtccggcac
ttcgccgagttcctctcccgctggggcgaccgacccgacatcatggaacgggtgaccacc
cgggtggaatgcgccgactacttcgagcaacgcaactccgcgctgctggcccacgccacg
cagatcgaccccaacggctggttcttcgccgccccggtggagatgcagcagcgtgtctgg
cccaccgaggagttcgaactcgcggcaagccgggtggccataccggcgcgagctgaggga
gaatacgagtcagacctgttcgagggcgtcgacccgtacgtcccgctgccggtcggaccg
agcacagcgaaggacccgcgatga

DBGET integrated database retrieval system