KEGG   Dyella japonica: HY57_06370Help
Entry
HY57_06370        CDS       T03215                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
dja  Dyella japonica
Brite
KEGG Orthology (KO) [BR:dja00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    HY57_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Chitin_bind_4
Motif
Other DBs
NCBI-ProteinID: AIF46917
UniProt: A0A075JZI1
Position
complement(1514189..1514572)
Genome map
AA seq 127 aa AA seqDB search
MNERSSYTIDVQVEPRFVPDQSRPGDNRYVFAYTITLHNAGDVAARLLTRHWIITDSNGK
VEEVTGEGVVGEQPWIRPGDEYEYTSGAVLETSVGVMQGSYQMVADDGTRFEAPIPPFTL
SIPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacgatcttcctacacgatcgacgtgcaggtcgaaccccgctttgtccccgac
caatcccgtcccggcgacaaccgctatgttttcgcctacacgatcacgctgcacaacgcg
ggcgacgtcgctgcgcgcctgctgacccgtcactggatcatcaccgactccaacggcaag
gtcgaagaagtgaccggcgaaggcgtcgtcggcgagcaaccgtggatccgccctggcgac
gagtacgagtacacctcgggcgccgtgctggaaacctcggtgggcgtgatgcagggcagc
taccagatggtggccgacgacggcacccgtttcgaggcgccgatcccgccgttcacgctt
tcgatcccgcgcaccctgcactga

DBGET integrated database retrieval system