KEGG   Dyella japonica: HY57_16335Help
Entry
HY57_16335        CDS       T03215                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dja  Dyella japonica
Pathway
dja00071  Fatty acid degradation
dja00072  Synthesis and degradation of ketone bodies
dja00280  Valine, leucine and isoleucine degradation
dja00310  Lysine degradation
dja00362  Benzoate degradation
dja00380  Tryptophan metabolism
dja00620  Pyruvate metabolism
dja00630  Glyoxylate and dicarboxylate metabolism
dja00640  Propanoate metabolism
dja00650  Butanoate metabolism
dja00900  Terpenoid backbone biosynthesis
dja01100  Metabolic pathways
dja01110  Biosynthesis of secondary metabolites
dja01120  Microbial metabolism in diverse environments
dja01130  Biosynthesis of antibiotics
dja01200  Carbon metabolism
dja01212  Fatty acid metabolism
dja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dja00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HY57_16335
   00630 Glyoxylate and dicarboxylate metabolism
    HY57_16335
   00640 Propanoate metabolism
    HY57_16335
   00650 Butanoate metabolism
    HY57_16335
  Lipid metabolism
   00071 Fatty acid degradation
    HY57_16335
   00072 Synthesis and degradation of ketone bodies
    HY57_16335
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HY57_16335
   00310 Lysine degradation
    HY57_16335
   00380 Tryptophan metabolism
    HY57_16335
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HY57_16335
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HY57_16335
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    HY57_16335
Enzymes [BR:dja01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HY57_16335
Exosome [BR:dja04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HY57_16335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIF48693
UniProt: A0A075K905
Position
complement(3822848..3824050)
Genome map
AA seq 400 aa AA seqDB search
MSAIDPIVIVSAVRTPLGRFQGALSSLPGHALGTAAIRAAIERAGVAPDAVDEVLMGCVL
PAGQGQAPARQAAIGAGIPTSVGATTVNKVCGSGMKATMLAHDLLRAGSAEVIVAGGMES
MSGAPYLLTKARGGYRVGHEQIFDHMMLDGLEDAYEKGRPMGDFGEMAAERYGFGRDAQD
AWAVDTLQRAQRAIGNGDFVDEIVPVEVRERAGTVLVDRDEHPQRVSPEKIPTLKPAFRS
DGTITAASASANADGAAALVLTRQSTAQREGWPILAVIRGHATHSQEPAWYTTAPAPAIR
RLLGRLDWSLDSVGLFEINEAFAVVPMIAAKELGIPRERINIHGGACALGHPIGATGARL
IVTLVHAMRHTGTKRGVASLCIGGGEATAVALELPEEATA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccatcgaccccatcgtcatcgtttccgctgtgcgcacgccgctcgggcgtttc
cagggtgcgctgtcttccttgcccgggcatgcgctgggaaccgcggcgatacgcgcagcc
atcgagcgtgccggcgtggcgccagacgccgtggacgaagtgttgatggggtgcgtgctg
cccgcggggcagggacaggcaccggcgcgccaggctgccatcggcgcgggcattccgacc
tcggtgggcgccaccaccgtcaacaaggtctgcggttccggcatgaaggccaccatgctg
gcgcacgatctgctgcgtgcgggcagcgccgaggtgatcgtggctggcggcatggagtcc
atgtccggcgccccgtatctgctgaccaaggcacgcggcggctatcgcgtgggccacgaa
cagatcttcgaccacatgatgctcgatggcctggaagacgcctacgagaaaggccgcccc
atgggcgacttcggggaaatggccgcggaacgctatggctttggacgggacgcgcaggat
gcctgggccgtcgacacgctgcagcgcgcgcagcgggccataggcaacggcgacttcgtc
gacgagatcgtgcccgtcgaggtgcgtgagcgcgcgggaacggtgctggtcgatcgcgac
gaacatccgcagcgcgtgtccccggaaaaaatccccacgctgaaacccgcgttccgtagt
gacggcaccatcacggcggccagcgcatcggccaatgcggatggcgcagcggcgctggtg
ctgacccgccagtcgaccgcgcagcgcgaaggctggccgatactcgcggtgatcaggggc
cacgccacgcattcgcaggaaccggcctggtacaccacggcacccgcaccggcgatccgc
agattgctgggccgactggactggtcgctcgacagcgtgggcctgttcgagatcaacgaa
gcgttcgccgtggtgccgatgatcgccgcgaaggaactgggcattccgcgcgagcggatc
aacatccacggcggcgcctgcgcgctgggccaccccattggcgccactggcgcgcgtctg
atcgtgacgctggtgcacgccatgcgtcacacaggaacgaaacgtggcgtggcatcgctg
tgcatcggcggcggcgaagcgacggccgtggcgctggagctgcctgaggaggcgacggcc
tga

DBGET integrated database retrieval system