KEGG   Dyella japonica: HY57_18190Help
Entry
HY57_18190        CDS       T03215                                 

Definition
(GenBank) uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
dja  Dyella japonica
Pathway
dja02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dja00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HY57_18190
Enzymes [BR:dja01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     HY57_18190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT ACT_6 NTP_transf_2
Motif
Other DBs
NCBI-ProteinID: AIF49037
UniProt: A0A075K5U2
Position
complement(4214443..4217097)
Genome map
AA seq 884 aa AA seqDB search
MTVAPIVLPPLPRLPVAVPRSGVSSEARRALRQLLGDVDRALDTAFRDGADATALAQRRS
ESVQRIVVHVWTACLGDVNDAALFAVGGFGRGLLFPHSDVDLLALVGPSEPARLRALEQC
FATLWDIGLKVGHAVRDLPQCRVLAKQDATVFTSLLDARRLVGDPAMEQGLKAIVDDPSI
WPPAEYLAVRRAERDARHARYNDTAYNLEPNLKDGPGGLRTLDALRWLGRRLAHADDFDE
MVAEGLLDPAEKDSLEQSEATLRRYRFALHLEAGRAEERLLFDYQRALAARLGFEDEHEK
NLGVEQFMQGYYRAASQVERLGVQIAERFEEMLEPPSDPRAVGEDFVRYGKRLAVRDPDL
FMRQPAALVEAFIARLGEPGITGFTAETMRRMHQASAVLDRTLGDDPEVLAAFLRLLRLG
APAVEALWRMNRHGLLAAILPAFGKVFGRMQYDLFHVYTVDEHTLRVLRNVARFADADAA
SDFPIACKIWPTLPKPELLLLAALFHDIAKGRGGDHSVLGEEDALAFGRRLGLPEEDTQL
VAWLVRWHLLMSTTAQRQDITDPDVVNRFAETVGAPERLDYLYLLTIADIIGTSPKLWNG
WKDRLLADLYTSTRYVLRSDDELPSDADARVRSCRDQAQALLEQEGFDADACQRLWRGFP
ESSFLRHRPEQIAWQTAAILRAKGETPLVEVHPKSVRGTTELFVYVPDRDGLFAAVTAML
DRLHFSVMEARILSSPTGMALDTFLLLESDTQQPATPERAEELKQRLHRALSQPGHVHQP
SRRSMSRHLKHFQAAPKIAFSTVHGRTRLALVCSDRPGLLAAVAQGMMDAGVRVHDARIA
TFGERVEDFFLMTDRHDAPLSVELQDRLLHTLLERLGPAKEKRA
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcgccccgatcgtgttgcctcccttgccccgccttcccgtggcggtgccgcgc
tcgggcgtgtcgtcggaggcgcgtcgcgcgctgcggcagttgctgggggacgtggatcgc
gcgctggatacggcgttccgcgatggggcggatgccacggcgctggcgcagcggcgcagc
gaatcggtgcagcgcatcgtcgtgcatgtatggacggcctgcctgggtgacgtgaatgac
gcggcgttgtttgccgtcggcgggttcggtcggggcttgttgttcccgcattcggacgtc
gatctgctcgcgctcgtcggcccgtcggagccggcacgcctgcgtgcgctggagcaatgc
ttcgccacgttgtgggatatcggtttgaaagtcgggcacgcggtgcgcgatctcccgcag
tgccgtgtgctggccaagcaggatgccaccgtgttcaccagcctgctcgacgcgcggcgg
ctcgtgggtgacccggcgatggagcaggggttgaaggccatcgtcgacgacccgtcgata
tggccgccggcggagtatcttgcggtgcggcgggccgagcgcgacgcgcgccacgcgcgc
tacaacgatacggcgtacaacctcgagcccaatctcaaggatggccccggcggcctgcgc
acgctcgatgcgctgcgctggctggggcggcgcctggcacatgcggatgacttcgatgag
atggttgccgaaggtctgctcgatccggcggagaaggactcgctcgaacaatccgaagcc
acgctgcggcgttaccggttcgcattgcacctggaagcaggacgtgcggaggagcgcctg
ctgttcgactaccagcgcgcgcttgcggcacgactgggctttgaggacgagcacgagaag
aacctcggcgtcgagcagttcatgcagggctattaccgcgccgcaagtcaggtggagcgc
ctgggcgtgcagatcgccgagcgtttcgaggaaatgctggagccgccttccgatccgcgt
gccgtgggtgaggacttcgtccgctacggcaagcggctggcggtgcgcgatcctgacctc
ttcatgcgccaacctgcggcgctggtcgaggcgttcatcgcgcggctgggtgaacccggc
atcaccggattcacggcggaaaccatgcgtcgcatgcaccaggcatcggcggtgctggat
cgcacgctgggtgacgatccggaagtgctcgctgctttcttgcgcctgctgcggctgggc
gcgccggccgtggaggcgttgtggcgcatgaatcgccatggcctgctggccgccatcctg
cctgccttcggcaaggtgttcggacgcatgcagtacgatcttttccacgtgtacacggtg
gacgaacacacgctgcgcgtgctgcgcaacgtcgcacgcttcgccgatgcggatgccgcg
agcgattttcccatcgcctgcaaaatctggccgaccctgcccaagccggagctgttgttg
ctggccgcgttgttccatgacatcgccaaaggccgcggcggagatcactccgtgctgggc
gaggaggatgcgctcgctttcggtcgccgcctcggcttgccggaggaagacacccaactg
gtcgcgtggctggtgcgctggcacctgctgatgagcacgacggcgcagcggcaggacatc
accgatcccgatgtggtgaatcgcttcgccgagacggtgggggctccggaacggctggat
tacctgtacctgctcaccatcgctgacatcattggcaccagtcccaagctgtggaacggc
tggaaagatcgcctgctcgcggacctctatacgtccacgcggtacgtgctgcgcagcgac
gacgaactgccctccgacgccgatgcgcgcgtgcgcagctgccgcgaccaggcccaggca
ctgctggagcaggaaggattcgacgccgacgcgtgccagcgcctgtggcgcggctttccg
gagtcgagtttcctgcgccatcgcccggagcagatcgcctggcaaaccgcggcgatcctg
cgggccaagggcgagacgccgctggtcgaggtgcatccgaaatcggtacgcggcaccacc
gaactattcgtctatgtgccggatcgcgacggcttgtttgccgccgtcacggcgatgctc
gaccgcctgcatttctcggtgatggaggctcgcatcctcagttcgcccacgggcatggcg
ctggatacgttcctgctgctggaatcggacacacagcagcccgccacgcccgagcgcgcc
gaagagctgaaacagcgtctgcatcgcgccctgtcgcagccggggcacgtgcaccagccg
tcgcgccggagcatgtcgcgccacctcaagcacttccaggcggcgcccaagattgccttc
agcaccgtgcacggccgtacgcggcttgcgctggtgtgcagcgaccgccccggcctgctc
gcggcggtggcgcaaggcatgatggatgcgggcgtgcgcgtgcacgatgcgcgcatcgcc
acctttggcgagcgcgtggaggatttcttccttatgaccgaccggcacgacgcaccgctc
agcgtggagctgcaggaccgcctgctgcatacgctgctcgagcggctggggccggcgaaa
gaaaaacgcgcctga

DBGET integrated database retrieval system