KEGG   Dyella japonica: HY57_18785Help
Entry
HY57_18785        CDS       T03215                                 

Definition
(GenBank) xanthomonalisin
  KO
K05999  xanthomonalisin [EC:3.4.21.101]
Organism
dja  Dyella japonica
Brite
KEGG Orthology (KO) [BR:dja00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:dja01002]
    HY57_18785
Enzymes [BR:dja01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.101  xanthomonalisin
     HY57_18785
Peptidases and inhibitors [BR:dja01002]
 Serine peptidases
  Family S53
   HY57_18785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro-kuma_activ PKD
Motif
Other DBs
NCBI-ProteinID: AIF49144
UniProt: A0A075K4R4
Position
complement(4335246..4337837)
Genome map
AA seq 863 aa AA seqDB search
MSFAMAGSLHATTHDGWVGVRTQAAMTHAVAPATALTTAAASGGSWTLSMHGSPKIDAAT
VSPLEASKPMHVALSLNLRNVNELETFLHAVNTPGSAQFHHFLTPAQFKARYAPTDAQVA
QVMAHLSQSGFSNVRVSPNNMLVEADGNANTVNAAFRTNMRTFQYGGKQRIANDSAVQVP
AALGGIVDSVLGLQNLNVPHTMHHIKGPVHAGANSVGIQATGTQASHNPQDFPAIYDVGS
TPTASNTKVGIITWGDLTQTITDLNTFTTNAGMSAVNTQVVKTGTSAYADDPNGDGEWNL
DSQTITGTSGGVNTLIFYTAPNCDANDSCLTDAAITAAYNRAVTDNVAKVINVSLGEDES
AANSSGTQAADDKIFAQAVAQGQTFSIASGDAGVYQWSTDSTGAPGYVANSAGTVQISLS
HYSVSEPATSPNVVAVGGTTLSTNGTAWAGETVWNEGLSAISQTDSNERLWATGGGVSLF
ESAPSWQTTALGSSATMRQVPDLAFDAAQSTGANIYIQGTAYQIGGTSLASPIFVGIWAR
ILSANNNTLGLPTQNMYAHFPTDASPLHDVTSGNNGYNGYGYAAKAGYDNSTGWGSLDIA
KFNSYVTQYWGGGGGGTTGGTPTANFSFVTNGLTATFTDSSTDTGGSISSYAWTFGDGGT
STSASPSHTYAAAGTYNVTETVTDGVSAKTSSKTSSVTVSGGSTPSQIIVNPGFETGAAT
PWSMSSGTLCSNSTCSGETAHSGTWFAWLDGYGTTHTDTVSQKVAIPSGKTSAKLTFYLH
VDTAETSTTTAYDKLSVQVLNSSGTVLKTLATYSNLNAASGYSLASFDLSAYIGQTVTLK
FTGTEDASLQTSFVLDDVNLTVQ
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttcgccatggcaggttcgttgcacgccaccacccatgacggctgggtcggcgtg
cgcacgcaggccgccatgacgcatgccgtggcgcccgccacggcactgaccacggcggca
gcctccggcggcagctggacgctgagcatgcacggctcgccgaagatcgacgcggccacc
gtgtcgccgctggaagccagcaagcccatgcacgtggcgctgagcctcaacctgcgcaac
gtgaatgagctggagaccttcctgcacgcggtcaacacgccgggcagcgcgcagttccac
cacttcctgaccccggcgcagttcaaggcgcgctacgcgccgaccgatgcccaggtggcg
caggtcatggcgcatctgagccagtccggtttcagcaacgtccgcgtatcgcccaacaac
atgctggtcgaggcggatggcaacgcgaacacggtgaacgcggcgttccgcaccaacatg
cgcaccttccagtacggcggcaagcagcgcatcgccaacgactcggcggtgcaggtgccg
gcggcgctgggcggcatcgtggattcggtgctcggcctgcagaacctcaacgtgccgcac
accatgcaccacatcaaggggccggtgcatgcgggcgccaacagcgtgggcatccaggcg
accggtacgcaggcgtcgcacaacccgcaggatttccccgcgatctatgacgtgggcagc
acgccgaccgcgtccaacaccaaggtcggcatcatcacctggggtgacctgacccagacc
atcaccgacctcaacaccttcaccaccaacgccggtatgagcgcggtgaacacccaggtg
gtgaagaccggcaccagcgcctacgcggacgatccgaacggcgacggcgaatggaacctg
gacagccagaccatcaccggcacctcgggcggcgtgaacacgctgatcttctataccgcg
ccgaactgcgacgccaacgacagctgcctcaccgacgccgccatcactgccgcgtacaac
cgcgccgtgaccgacaacgtggccaaggtgatcaacgtgtcgctgggcgaagacgaatcg
gcggcgaacagctccggtacgcaggccgccgacgacaagatcttcgcgcaggccgtggcg
cagggtcagactttctccatcgcctcgggcgatgcgggcgtgtaccagtggtccaccgac
tcgaccggtgccccgggctacgtcgccaactcggctggcacggtgcagatctcgctgagc
cactactcggtgagcgagccggccacctcgccgaacgtggtggcggtgggcggcaccacg
ctgagcaccaacggcacggcctgggcgggtgaaacggtgtggaacgaaggcctgtcggcc
atcagccagacggatagcaacgagcgcctgtgggcgaccggcggcggcgtgagcctgttc
gaatccgccccgagctggcagacgacggcgctgggttcgtcggccacgatgcgccaggtg
cctgaccttgcgttcgatgccgcgcagtcgaccggcgcgaacatctacatccaaggcacc
gcctatcagatcggcggcaccagcctggcctcgccgatcttcgtcggtatctgggcgcgt
atcctctcggccaacaacaacacgctgggcctgccgacccagaacatgtacgcccatttc
ccgaccgacgcctcgccgctgcatgacgtcacctcgggcaataacggctacaacggctac
ggctatgccgccaaggccggctacgacaactccaccggctggggttcgctcgacatcgcc
aagttcaacagctacgtgacccagtactggggcggcggcggtggcggcaccacgggtggc
acgccgacggcgaacttcagctttgtcaccaacggcctgaccgccaccttcaccgacagc
tcgacggatacgggtggcagcatctcctcgtacgcgtggaccttcggcgacggcggcacc
tcgacctcggccagcccgagccacacctacgccgctgccggcacgtacaacgtgacggag
acggtgacggacggcgtgagcgcgaagacctcgagcaagacgtcctcggtgacggtgtcg
ggcggcagcacgccgtcgcagatcatcgtgaacccgggcttcgagactggcgcggccacg
ccgtggtcgatgagctccggcacgctctgcagcaacagcacctgcagtggcgagacggcg
cacagcggcacctggttcgcctggctggacggctacggcaccacgcacaccgacacggtg
tcgcagaaggtggccatccccagcggtaagacctcggccaagctgacgttctacctgcat
gtcgataccgccgagaccagcaccaccacggcgtacgacaagctgagcgtgcaggtgctc
aacagcagcggcacggtgctgaagacgctggcgacgtactcgaacctcaatgcggcttcg
ggttattcgctggcgagcttcgacctcagcgcgtatatcggccagacggtgacgctgaag
ttcaccggtacggaagacgcgtcgctgcagacctcgttcgtgctcgacgacgtgaacctg
acggtgcagtaa

DBGET integrated database retrieval system