KEGG   Dyella jiangningensis: CH75_00555Help
Entry
CH75_00555        CDS       T03074                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dji  Dyella jiangningensis
Pathway
dji00010  Glycolysis / Gluconeogenesis
dji00020  Citrate cycle (TCA cycle)
dji00620  Pyruvate metabolism
dji01100  Metabolic pathways
dji01110  Biosynthesis of secondary metabolites
dji01120  Microbial metabolism in diverse environments
dji01130  Biosynthesis of antibiotics
dji01200  Carbon metabolism
Module
dji_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CH75_00555
   00020 Citrate cycle (TCA cycle)
    CH75_00555
   00620 Pyruvate metabolism
    CH75_00555
Enzymes [BR:dji01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CH75_00555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Ribosomal_L29
Motif
Other DBs
NCBI-ProteinID: AHX11949
UniProt: A0A023NYV5
Position
complement(120473..121861)
Genome map
AA seq 462 aa AA seqDB search
MADIKTFYLPDLGEGLPDATIVEWHVKEGDTIKLDAPLVSMETAKAVVDVPSPYTGKVTK
LHGAAGDIIETGAALAEFEPDPNAKQRAEAESTGHHHGPKKGAGSPAPDQGKKVIASDEG
GEIDSNGKADREDEGTVVGAMISGSHVHVEQASSVGGVKAVPAVRALAKKLKVDLARVTP
TGADGVVTMTDVKNAAANGSAQLGAAPARAAVPASAGRHLAPQLPEPEPARTATSLAGKP
VRTAPPSVQASGQPEQLKGVRRNMARVMAEAHANVVPTTLVDDADLHAWIGKQDITARLI
RSIVVACKTVPALNAWFDGKNLTRTLHPHVDIGIAVDTEEGLFVPALRNADVLDGAGIRA
AIKRLRMSVEDRSIPASELSGYTISLSNFGMFAGRYATPVVVPPCVAIIGAGKLSHDVVA
VMGGIEVHRRMPISLTFDHRAATGGEAARFLKALLDDLSLPN
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgatatcaagacgttctacctgcccgacctcggcgaaggccttcccgacgcaacc
atcgtcgagtggcacgtgaaggaaggcgacaccatcaagctcgacgccccgctggtgtcg
atggaaaccgccaaggccgtcgtcgacgtgccgtccccgtatacgggcaaggtcaccaag
ctgcacggcgccgccggcgacatcatcgagaccggcgccgcgctggccgagttcgagccc
gacccgaacgccaagcagcgtgccgaagccgagtccaccgggcaccaccatggcccgaag
aaaggcgccggcagcccggccccggaccagggcaagaaagtgatcgcctccgatgagggc
ggcgagatcgacagcaacggcaaggccgatcgcgaagacgaaggcaccgtggtcggcgcg
atgatctccggcagccacgtgcacgtggagcaggccagcagcgtcggcggcgtgaaggcc
gtgccggcggtgcgcgcgcttgccaagaagctcaaggtcgacctcgcccgcgtgacgccg
actggcgccgacggcgtggtcaccatgaccgacgtgaagaatgccgccgccaacggcagc
gcccagctcggcgccgctccggcccgcgctgcggtgccggcctctgccggtcgtcacctc
gccccgcagctgccggagcccgaaccggcccgcacggccacctcgctcgccggcaagcca
gtgcgcacggcgccgccgagcgtgcaggccagtggccagccggaacagctcaagggcgtc
cgtcgcaacatggcgcgcgtgatggccgaggcccacgccaacgtcgtgccgaccacgctg
gtcgatgacgccgacctgcacgcctggatcggcaagcaggacatcaccgcgcgcctgatc
cgttccatcgtggtggcctgcaagaccgtgccggcgctcaacgcctggttcgacggcaag
aacctcacgcgcacgctgcatccgcacgtggacatcggcatcgccgtggacaccgaggaa
ggcctgttcgtgcccgcgctgcgcaacgccgacgtgctcgacggcgccggcattcgcgcc
gcgatcaagcgactgcgcatgtcggtggaagaccgttccatcccggcgtcggagctctcg
ggctacaccatcagcctttccaacttcggcatgttcgccggccgctacgccacgccggtc
gtcgtgccgccgtgcgtcgccatcatcggcgcgggcaagctcagccacgacgtagtggcg
gtgatgggcggcatcgaagtgcatcgccgcatgccgatctcgctgacgttcgatcatcgc
gccgccaccggcggcgaagccgcgcgcttcctcaaggcgctgctcgacgatctgtcgctg
ccgaactaa

DBGET integrated database retrieval system