KEGG   Dyella jiangningensis: CH75_11075Help
Entry
CH75_11075        CDS       T03074                                 

Definition
(GenBank) polysaccharide biosynthesis protein
  KO
K01912  phenylacetate-CoA ligase [EC:6.2.1.30]
Organism
dji  Dyella jiangningensis
Pathway
dji00360  Phenylalanine metabolism
dji01100  Metabolic pathways
dji01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    CH75_11075
Enzymes [BR:dji01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.30  phenylacetate---CoA ligase
     CH75_11075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AHX13670
UniProt: A0A023NSE6
Position
2393108..2394466
Genome map
AA seq 452 aa AA seqDB search
MSGWYEQAFRQVLYPAYESGLRRRDTLSWLSKYETDQWLSPGGIADLQFRRLKSLLDHCY
REVPYYRRRWRELGITPDDIQDMDDFARLPTLTKADIRENFQDLQASSWRSRLLFKRTGG
STGEPLELGYTRESYDRRMAVMWRGYGWAGARPGRRTLYLWAGNVGTPGRAHQWKDRLYN
AMFARRVLNSFEMTETNLASYADAIDRYRPDIIVGYVGPLAQLAQWMVATGRRVHRPESV
IGAAEALHPFQREVIGQAFGCPVYNTYGCREFMLIASECDHHHRLHVNADHLVVELLGED
GTRVRRGTGEVAITDLSNYGMPFIRYVNGDLASTSSEYSCPCGRGLPLLDRIEGRVLDAI
RTPDGRILPGEFFPHMLKDVRGLSRFQLVQRQLDRLELSIVRSEGFDDDSLAYIHRETAR
VLGNQVTLECRFVDDIPLTRSGKRRVTLSELA
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctggtacgaacaagcgtttcgccaagtgctttatcccgcttacgaaagcggc
ctgcgccgccgggatacgctgtcgtggctatcgaaatacgaaaccgaccagtggctgtcg
cccggcggcatcgcagacctgcagttccgccggctcaagagcctgctcgaccattgctat
cgcgaagtgccgtactaccgtcgccgctggcgcgaactcggcatcacgccggacgatatc
caggacatggatgactttgcccgcctgcccacgctgaccaaggccgacatccgcgagaac
ttccaggatctgcaggcctcgtcgtggcgcagccgcctgctgttcaagcgtacgggcggc
tccactggcgagccgcttgaacttggttacacgcgcgaaagttacgaccggcgcatggcc
gtgatgtggcgcggctacggctgggccggtgcgcgtccgggccgccgcacgctttacctg
tgggccggcaacgtgggcacgccgggccgtgctcatcagtggaaagatcggctttacaac
gccatgttcgcgcgccgcgtgctcaacagcttcgagatgaccgaaaccaatctggccagc
tacgccgacgcgatcgaccgttaccggccggacatcatcgtcggctatgtgggaccgctg
gcccagcttgcacaatggatggtggccacggggcgacgcgtgcaccgccccgagtcggtc
atcggtgcggccgaagcgctgcacccattccagcgcgaggtgatcggccaggccttcggc
tgcccggtctacaacacgtacggctgccgcgagttcatgctgatcgcctccgaatgcgac
caccaccatcgcctgcacgtcaacgccgaccatctcgtggtcgagctgctcggcgaagac
ggcacgcgcgtgcggcgtggcaccggcgaggtggcgattaccgatctgtccaactacggc
atgcccttcatccgctacgtcaatggcgacctggcaagcacctcctcggagtacagttgt
ccgtgcggccgtggcctgcctttgctggaccgcatcgaggggcgcgtgctcgacgccatc
cgcacgccggacgggcgcatcctgccgggcgaattcttcccgcacatgctcaaagacgtg
cgtggcttgtcacgcttccagctggttcagcggcagctggatcgcctcgaactctccatc
gtgcgcagcgaggggttcgacgatgactcgctcgcctacatccatcgcgagaccgccagg
gtgctgggcaaccaggtgacgctcgaatgccgcttcgtcgacgacattccccttacccga
agcggcaagcgccgcgtcaccctgtcggaactggcttga

DBGET integrated database retrieval system