KEGG   Dyella jiangningensis: CH75_13800Help
Entry
CH75_13800        CDS       T03074                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dji  Dyella jiangningensis
Pathway
dji00071  Fatty acid degradation
dji00072  Synthesis and degradation of ketone bodies
dji00280  Valine, leucine and isoleucine degradation
dji00310  Lysine degradation
dji00362  Benzoate degradation
dji00380  Tryptophan metabolism
dji00620  Pyruvate metabolism
dji00630  Glyoxylate and dicarboxylate metabolism
dji00640  Propanoate metabolism
dji00650  Butanoate metabolism
dji00900  Terpenoid backbone biosynthesis
dji01100  Metabolic pathways
dji01110  Biosynthesis of secondary metabolites
dji01120  Microbial metabolism in diverse environments
dji01130  Biosynthesis of antibiotics
dji01200  Carbon metabolism
dji01212  Fatty acid metabolism
dji02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dji00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CH75_13800
   00630 Glyoxylate and dicarboxylate metabolism
    CH75_13800
   00640 Propanoate metabolism
    CH75_13800
   00650 Butanoate metabolism
    CH75_13800
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CH75_13800
   00072 Synthesis and degradation of ketone bodies
    CH75_13800
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CH75_13800
   00310 Lysine degradation
    CH75_13800
   00380 Tryptophan metabolism
    CH75_13800
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    CH75_13800
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CH75_13800
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CH75_13800
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dji04147]
    CH75_13800
Enzymes [BR:dji01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     CH75_13800
Exosome [BR:dji04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CH75_13800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ACP_syn_III ketoacyl-synt DUF3323
Motif
Other DBs
NCBI-ProteinID: AHX14150
UniProt: A0A023NTU1
Position
2975895..2977079
Genome map
AA seq 394 aa AA seqDB search
MSDVSVVIAGAKRTAIGSFLGQFTGVPTPTLGATAIRAALEQSGLAPTDVTEVIMGCVLP
ANLGQAPARQASLGAGLPVSAGCTTVNKVCGSGMKAIMLGHDLIKAGSAAIVVAGGMESM
TNAPHMVNARTGIRYGDGTLVDHMAWDGLTNPYDGKAMGVFGELCADKYHFTREEQDTFS
TESVERAKAAQQSGAFAGEIVPVTVASRKGEVKVDTDEQPGRSDVSKIPTLKPAFRKENG
TITAASSSSISDGAAAVVLLSADDAKARGLKPLARIVAHATHSQEPEWFTTAPVGALHKV
LEKAGWKVSDVDLFEVNEAFAVVAMAAMRELDIPRDKINVNGGACALGHPIGASGARLVV
TLLNALKTRGLKRGVASLCIGGGEATAVAVELLD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgtcagcgtcgtcatcgccggtgccaagcgcaccgccattggctcctttctc
ggccaattcaccggcgtacccacgcccaccctgggcgccacggccatccgcgcggcgctg
gaacagtcgggcctggcgccgaccgacgtcaccgaagtgatcatgggctgcgtgctgcct
gccaacctcggccaggcgcccgcacgtcaggcctcgctgggcgccggcctgccagtgtcc
gccggctgcaccacggtcaacaaggtctgcggctcgggcatgaaggcgatcatgctgggc
catgacctgatcaaggccggctcggccgccatcgtggtggcgggcggcatggaatcgatg
accaatgcaccgcacatggtcaatgcccgcaccggcattcgctacggcgacggcaccctc
gtcgaccacatggcgtgggacggcctcaccaatccgtacgacggcaaggccatgggcgtg
ttcggcgagctgtgcgccgacaagtaccacttcacccgcgaagagcaggacacgttctcg
accgaatcggtggagcgcgccaaggccgcgcagcaatccggcgccttcgccggcgaaatc
gtcccggtcaccgtggccagccgcaagggcgaagtgaaggtcgacacagacgagcagcct
ggtcgctccgatgtcagcaagatcccgacgctcaagccggcgttccgcaaggagaacggc
accattacggccgccagctcttcgagcatttccgatggtgccgccgccgtggtgctgctc
tccgccgacgacgccaaggcccgtggtctcaagccgctggcccgcatcgtggctcatgcc
acccactcgcaggaaccggaatggttcaccaccgcgccggtgggtgcgttgcacaaggtg
ctggaaaaggccggctggaaggtctctgacgtggacctcttcgaggtcaacgaagccttc
gccgtggtggccatggcggccatgcgcgagctggacatcccgcgcgacaagatcaacgtc
aacggtggcgcctgcgccctgggccatccgatcggtgcgagcggtgcccgcctggtggtc
accctgctcaatgcactgaaaacccgtggcctcaagcgcggcgtggcgtccctgtgcatc
ggcggcggcgaagcgaccgcggttgccgtggaactccttgattaa

DBGET integrated database retrieval system