KEGG   Dyella jiangningensis: CH75_14270Help
Entry
CH75_14270        CDS       T03074                                 

Definition
(GenBank) tRNA(Ile)-lysidine synthetase
  KO
K04075  tRNA(Ile)-lysidine synthase [EC:6.3.4.19]
Organism
dji  Dyella jiangningensis
Brite
KEGG Orthology (KO) [BR:dji00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dji03016]
    CH75_14270
Enzymes [BR:dji01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.19  tRNAIle-lysidine synthase
     CH75_14270
Transfer RNA biogenesis [BR:dji03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    CH75_14270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP_bind_3 TilS_C TilS
Motif
Other DBs
NCBI-ProteinID: AHX14231
UniProt: A0A023NTL3
Position
3078858..3080147
Genome map
AA seq 429 aa AA seqDB search
MSELACVLRNVLRKEPQGALCVAYSGGPDSTALLHALAQLPEAQERGLRALHVDHGLHAD
SHAWATHCRELAQAWQVPCLVLRVDVNHASGYGLEAAARDARYRAFALSLHDGERIVLGH
HRDDQAETVLLKLLRGAGPEGLGGMRGLRPLGRGLLWRPLLDVSREALRRYVDTHGLPCI
ADPSNADHRLTRNFLRHEILPRLTDHWPQAVESIVHSARHSREAAEVLSRQWRAARDALL
DPATGSLDAGGWLTLLPALRHPLLDDWLHTRGLPAPTTAQRAQIERQCLARDGQLPCIRW
PGAEIHVWKGRLWALPPQRAIDPQWRADWSGAPLALPDGGSLQLEPAGRLAEPVSVRLRQ
GGEQLRPAGNPHTRELRDLMQQNGMPPWRRLACPLLYAGGELVGVGDRWLTERGVQLFGA
HRPLWHPAF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgagctcgcatgcgttcttcgcaatgtcctgcgcaaggagccgcagggagcgttg
tgcgtggcgtacagcggcggtcctgactccaccgcgctgctgcatgcgctcgcgcaattg
cccgaggcgcaggagcgtgggttgcgcgcattgcacgtcgatcacggcttgcacgccgac
agccacgcctgggccacgcattgccgcgaactcgcgcaggcatggcaggtgccctgcctc
gtgctgcgcgtggacgtgaaccacgccagcggttatggcctggaagccgccgcgcgcgac
gcgcgttatcgcgccttcgcgctctcgctgcatgacggcgagcgcatcgtgcttggccac
caccgggacgaccaggcggaaaccgtgttgctgaaactgttgcgcggcgccgggcccgag
ggcctgggtggcatgcgtggcctgcgtccgcttgggcgcggcctgctgtggcggccgctg
ctggacgtatcgcgcgaagcattgcggcgttacgtcgacacgcatggcctgccctgcatc
gccgatccgtcgaacgccgaccatcgactgacccgcaacttcctccgtcacgagatcctg
ccgcgactcactgaccattggccgcaggcagtcgaatcgatcgtgcatagcgcacgccac
agccgggaagctgccgaagtcctatcgcggcaatggcgtgctgcgcgcgacgcattgctc
gaccccgcgacgggaagtctcgatgccggcggctggctcacgctgctgccggccttgcgg
catcccttgctggacgactggctacacacgcgcggcctgccggcccccaccaccgcgcag
cgtgcacagatcgagcgccagtgcctggcgcgtgatggccagctgccatgcatccggtgg
ccgggcgccgagatccacgtgtggaagggccgcctgtgggcgctgccgccgcagcgtgcg
atcgacccgcaatggcgtgccgactggtccggtgcgccgctggccttgcccgatggcggg
agcctgcagctggaaccggcgggccgactcgccgaacccgtcagcgtgcgcctgcgccag
ggcggcgaacagttgcgccctgccggcaatcctcacacccgcgagctgcgggatctcatg
caacagaacggcatgccgccgtggcgtcgcctggcgtgcccgctgctgtacgcgggcggc
gaactggtgggcgtgggcgatcgctggctgaccgaacgaggcgtgcagctgttcggtgcg
cataggcccctctggcatccggccttctga

DBGET integrated database retrieval system