KEGG   Dyella jiangningensis: CH75_16440Help
Entry
CH75_16440        CDS       T03074                                 

Definition
(GenBank) magnesium transporter ApaG
  KO
K06195  ApaG protein
Organism
dji  Dyella jiangningensis
Brite
KEGG Orthology (KO) [BR:dji00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    CH75_16440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AHX14623
UniProt: A0A023NVZ8
Position
3539065..3539448
Genome map
AA seq 127 aa AA seqDB search
MNDRSSYTIDVQVEPRFVPDQSRPGDNRYVFAYTITLHNAGDVPARLLSRHWVITDANGK
VEEVTGEGVVGEQPWMRPGDRYEYTSGAVLETSVGVMEGSYQMLADDGTHFEAQIPAFTL
SIPRTLH
NT seq 384 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacagatcttcctacacgatcgacgtgcaggtcgaaccccgctttgtccccgac
caatcccgtcccggcgacaaccgctatgttttcgcctacacgatcacgctgcacaacgcg
ggcgacgtgcctgctcgcctgctctcgcgccactgggtcatcacggatgcgaacggcaag
gtggaggaagtcaccggcgaaggcgttgtcggcgaacagccgtggatgcgtcccggcgac
cgctacgaatacacctccggcgccgtactggaaacctcggtgggcgtgatggaaggcagc
taccagatgctggccgatgacggcacgcatttcgaagcgcagatcccggcgttcacgctg
tccattccgcgtacgctgcactga

DBGET integrated database retrieval system