KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0012Help
Entry
DKAM_0012         CDS       T00817                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00010  Glycolysis / Gluconeogenesis
dka00030  Pentose phosphate pathway
dka00051  Fructose and mannose metabolism
dka00052  Galactose metabolism
dka00230  Purine metabolism
dka00500  Starch and sucrose metabolism
dka00520  Amino sugar and nucleotide sugar metabolism
dka00521  Streptomycin biosynthesis
dka01100  Metabolic pathways
dka01110  Biosynthesis of secondary metabolites
dka01120  Microbial metabolism in diverse environments
dka01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DKAM_0012
   00030 Pentose phosphate pathway
    DKAM_0012
   00051 Fructose and mannose metabolism
    DKAM_0012
   00052 Galactose metabolism
    DKAM_0012
   00500 Starch and sucrose metabolism
    DKAM_0012
   00520 Amino sugar and nucleotide sugar metabolism
    DKAM_0012
  Nucleotide metabolism
   00230 Purine metabolism
    DKAM_0012
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DKAM_0012
Enzymes [BR:dka01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     DKAM_0012
    5.4.2.8  phosphomannomutase
     DKAM_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACL10341
UniProt: B8D370
Position
complement(9687..11063)
Genome map
AA seq 458 aa AA seqDB search
MSDPRRLFGTDGVRGVVNEDLNPEFILRLGLAIGSYFDKGSRVLIGMDSRAGGEIIKGIV
SAALMSTGVKVYDAGFTPTPALQYVVKSNGFDGGVMITASHNPPEYNGIKVIGPYGIEIN
RDEERKIEEIYWESNFRRVNWSSLPYSVEKHKMVNEEYVKAVLSHIDKDLIRAKNYRVLI
DPANSVGALTTPLIVKELGAKPIVINGTLDPLFPGRNPEPTVENLAETAKVTRELGVALG
IAHDADADRAIIIDEKGVVNWGDRTATLLAKYLKEEKGLSGKVYTAVSSSIMVEEVLKPL
NIEVAWLKVGSVDIAHTMRRNGDALCGFEENGGFMYPPHQYVRDGGMTTALFLEMMARYN
ASASQLFDKLPKYYTLKKKYKMDREKALRVVELVKEAFKDKRLITIDGVKVISSNYWFLV
RPSGTEPLLRVMIEAKDVERLNEISSSIDSIIREVVGK
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatccccggagacttttcggaaccgatggagtcagaggggttgtaaacgaagac
ttaaacccggaatttatactgagactcgggctagcaataggctcctattttgataaaggc
tccagggtacttattgggatggattcaagggctgggggcgagataattaagggcattgtt
tcagcagcactaatgtcaacaggtgtaaaggtatatgatgctggattcacccccacacca
gcccttcaatacgttgtcaaatctaatggctttgatggaggagttatgattacagccagc
cataaccctcccgaatataacgggataaaggtgatcggcccctacggaatcgagatcaat
agggatgaagaaagaaagatagaagagatatattgggaaagcaatttcaggagggttaac
tggagtagtctaccgtatagtgtagagaaacataagatggttaacgaggaatacgtgaaa
gctgtgttaagccatatagataaggaccttattagagccaagaactatagggtactcata
gatccagctaatagtgttggcgcattaacaacgccgctaatagttaaggaactaggtgca
aaaccaattgtaattaatggaacactagatcccttattccctgggagaaaccctgagcca
acagttgaaaacctggctgaaacagcgaaggtaacaagggagttaggagtcgcattaggt
atcgcacatgacgctgatgccgatagagctataataatagatgaaaaaggcgttgtcaac
tggggagatcgaacagcaacgcttctagctaaatatctgaaagaggagaagggattaagt
gggaaggtctatactgctgtatcatccagcataatggtggaggaggttttgaaacccctc
aacatagaggttgcctggcttaaagtgggtagtgtcgatatagctcacaccatgagaagg
aatggtgatgccttatgtggattcgaggagaacggtggattcatgtatccaccccaccaa
tatgtacgtgatggaggaatgaccactgcattatttctcgagatgatggccaggtacaat
gcatcagcatcacaattattcgataagctaccaaagtattataccttgaaaaagaagtat
aagatggatcgtgagaaggctttaagagtggttgaactagttaaagaagcgtttaaggat
aaacggttaataacgatcgatggtgtaaaagtcatctcatccaattactggtttctagtg
cggccaagcggtacggaacccttgctccgagtaatgatcgaggctaaggatgttgaacga
ttgaatgagatatcatcatcgattgattcgataataagggaggtggtaggtaagtga

DBGET integrated database retrieval system