KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0588Help
Entry
DKAM_0588         CDS       T00817                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dka  Desulfurococcus amylolyticus 1221n
Brite
KEGG Orthology (KO) [BR:dka00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    DKAM_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ACL10914
UniProt: B8D483
Position
complement(549299..550498)
Genome map
AA seq 399 aa AA seqDB search
MDPIVLAGFVGAFMLAWIDGANNAANSIGTIIGVRALPVRRALLIASIFELIGGLAYGRF
ISSTLSSKIVSVAEISSRIITAGFVIALFVSFIIVFLATRKHMPFSISIVTVGAISGIGL
AMGVEYVNTGLLLELFVLWLLIPFIGLLVGYIYYRLYSYLRSRRNIYVKIFLPLLLLYTS
FTVSAVYMAIPEQLLENIYILAAVSSIIVVLTASIMIYLYMNIWGSRHEVIDVDTVVNRF
NNRMLIASSAILAFTHGGHDVANAAAPLMLILGSRELNHDIESLLILTYSSLGLSTGILT
WGVSVAKTIGEEITVLNPESVLIANIAGAQTTLIVTRLGLPSSMVGIIIGSIMGVGLGRG
ISSVNTRLFSRMLSYWYIGFLVATVVTYIATRILLYVSI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggatccaatagttttagcagggtttgtaggagcgttcatgcttgcatggattgatggg
gcaaacaatgctgcaaacagcattgggacaatcataggtgtgcgtgcattgcctgtaaga
agggccttgttgattgcatcgatcttcgagttgatcgggggcctggcttacgggagattc
atttcttcaactctttcctccaagatagtcagcgtggcagagatatcgtcgaggataatt
accgctggcttcgtcatcgccttatttgtctcatttataatagtgttcctggcgactaga
aagcatatgccgtttagtataagcatagttacagtgggagctatttcaggaataggttta
gctatgggtgtggaatatgttaatacaggcctacttctcgagttatttgttctatggctt
ttaatacctttcataggcttactggtcggctatatatattataggctatatagctacctg
cgctcgagaagaaacatctatgtaaagatattcctccccctcttgctcctatacacctcc
ttcactgtttcagccgtatatatggctataccggagcagttactggagaacatatatatt
ctcgcagccgtgtcatcgatcatcgttgtccttacagcatcaataatgatatacctctac
atgaatatatggggaagtagacatgaagtgatagatgtagatactgttgtaaataggttc
aataatagaatgctcatcgcttcatcagcgatccttgcctttacacatggaggacatgat
gtcgcaaacgctgccgcaccattaatgcttatactgggttcaagggagttgaatcatgat
attgaatcactactgatactcacctattcttcactaggattgagcacaggaatccttaca
tggggtgttagcgtagcgaaaactattggggaagagatcactgtattaaatcccgagtca
gttctcattgctaacatagctggcgcgcagacaacactcattgtaaccaggcttgggtta
ccgagcagtatggttggaataatcattggttccataatgggggttggactgggaagaggt
atttcaagtgttaataccaggttattttcaaggatgctatcatactggtatattggtttc
ctagtagccactgtagttacatatattgctactagaatactattatatgtcagtatatag

DBGET integrated database retrieval system