KEGG   Desulfurococcus amylolyticus 1221n: DKAM_0607Help
Entry
DKAM_0607         CDS       T00817                                 

Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00970  Aminoacyl-tRNA biosynthesis
Module
dka_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:dka00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    DKAM_0607
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dka01007]
    DKAM_0607
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dka03016]
    DKAM_0607
Enzymes [BR:dka01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     DKAM_0607
Amino acid related enzymes [BR:dka01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   DKAM_0607
Transfer RNA biogenesis [BR:dka03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    DKAM_0607
 Prokaryotic Type
   Other AARSs
    DKAM_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 Arch_flagellin tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ACL10933
UniProt: B8D4A2
Position
569647..572823
Genome map
AA seq 1058 aa AA seqDB search
MSGNTEWLLQGGYKPRDVEEKVLGFWESMNIYRLVKKENESHTKRFNFIDGPPYPSGEIP
HIGTAWNKTLKDAVLRYKRMKGFRVYDIPGYDCHGLPIEVKVEQKLGVSVKKEIEEKIGV
ERFIEECKRLALSNAKAMTKWFKELGVFMDWDNPYLTLRDKYIEAEWWLIKKAHEAGLLE
EEYRVVHWCPRCSTTLAEYELEYHELEDPSIYVKFKVEGKENEYLVIWTTTPWTLPANTF
VMIHPDEDYVKAVVGGETWILAKKRLEAVMREAGVKEYQVVEEAKGYQLVGLRYSHPLTD
IVPLQEKLREYHVVLPAPEFVTMYEGTGLVHAAPGHGFEDFIVARRNNIEFVASPIDDEG
RFTSEAGKYAGLHAREANNVIIEDLRARNALVNASTIVHKYPVCWRCKTPVVMRATRQWV
IKVSKLKEKLREEVNGVKWIPEWARSRIESMIDNLQDWLVSRQRYWGTPLPIWECPNKHR
IVIGSIRELLEYGGEMPKELHRPWIDKVVLKCPYCGLEMHRVPDVIDVWLDSGVAFYAAK
GHPGNLSLEDIILDFIVEGHDQTRGWFFSLLRAGVLGFNKSPYKIVLVHGFMLDEKGREM
HKSLGNYVGTDEAIAKVGRDPLRLWLASNTIWEDARFSWKSLEDALKDLSILWNVAVFAY
TYMSLDRFNPGEYSLEKVAGYLRIEDKWILSRINTLIKKVTELMDSYELYIAVRLIREFF
IEDLSHWYIRLIRPRVWVEENTGDKLAAYAVLYYVLDRVVRLLAPFTPFISEYIYQALMK
PVYGKQSVHLLEFPETDSSLIDEGLEKEMDILRKIYETAGAARMKQGIKFRQPVKRLIVY
TDRKEIVEAVSRNMELVKAITNSKEVLVEPPRLMGEIVRYKVEPVYKSIGPRYKSLTKQV
LRYIEENQERIAFDILNNGKHEADVNGLRIILTKDDVVITPYYIEGYSVEDAEWGSVAID
TVLSEGEIAEGIARDLVRRIQVMRKMLNLQLDARIKTTIMTPPDKMQLVEKMSSYIMNET
RSIELKIMPGYNGRDSLRGFTQSWDINDEEYIIGIEVV
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgagtggaaacacagagtggcttttacaggggggttataagccccgggatgtcgaggaa
aaggtacttggattctgggaatccatgaatatttacaggctcgttaaaaaggagaatgag
tctcatactaagagattcaatttcattgatggcccaccctatccctcaggtgaaataccg
catattggcacagcatggaataagacgcttaaggatgccgtattaagatacaagaggatg
aagggttttagagtatatgacatacccgggtacgattgccatggactaccaatagaggta
aaagtagagcagaaactcggtgtaagtgttaagaaggagatcgaggaaaagataggtgtc
gaacgcttcatagaggagtgtaagaggcttgccctctccaatgctaaggctatgactaaa
tggtttaaagaactcggtgtcttcatggactgggataatccatacctgactctgagagac
aagtatatcgaggcagagtggtggctcataaagaaagctcatgaagccggacttcttgaa
gaagaatatagggtagtgcattggtgccctaggtgttcgacaaccctggcggagtacgag
ttagaataccatgaactagaggatccaagcatatatgtgaagttcaaagttgagggcaag
gagaacgagtacttggtgatttggacgactacgccatggactctcccagccaataccttc
gtgatgattcaccctgatgaagactatgtaaaagccgtggttggcggagaaacatggatc
ctagccaagaagagacttgaagcagtgatgcgtgaagccggtgtaaaggaataccaggtc
gtagaggaggcgaaggggtatcagttggtcgggttaagatatagtcacccactcaccgat
atcgtgcctctacaggagaagctgagggaataccatgtagtattgccggccccggagttc
gtgacaatgtatgagggtacagggttagtgcatgccgcgccgggtcatggtttcgaggac
ttcattgtagctaggaggaataatatcgagtttgttgcaagtccgatcgatgatgagggc
aggtttactagtgaggcgggtaaatatgcgggtcttcatgctagggaagctaataacgtg
ataatagaggatctaagggctagaaacgcgcttgtaaacgcgtcaaccatagtgcacaag
tatcctgtgtgctggaggtgtaagacaccagttgtcatgagggctacgaggcaatgggtg
attaaagtatccaagctgaaggagaagttgagagaggaagtgaatggtgttaaatggatc
cctgagtgggctcggagcaggatagaatccatgattgataacctgcaggactggttggtt
tcaaggcagaggtattggggtaccccgctacctatatgggaatgtccgaacaagcataga
atagttatcgggagcatcagggagctgctagagtatggtggtgagatgccaaaggagctc
catagaccatggattgataaagtagttttaaagtgtccctactgtggcttagagatgcat
cgcgtcccagacgttatcgacgtgtggcttgatagtggtgtagcattttacgctgctaaa
ggacatccaggaaacttgagtcttgaagatataatactagactttatagtagagggacac
gatcagaccaggggatggtttttctccctgttaagggccggtgttctaggctttaacaag
tctccatataagatagtgctggtccatggcttcatgttggatgagaaaggtagggagatg
cataagagcctagggaattatgttggcacggatgaggcaatcgccaaggttgggagggat
ccgcttagactatggctggctagtaacacgatatgggaggatgcaaggttctcgtggaag
agcttggaggatgccttaaaggatctctcaatactgtggaatgtagcagtatttgcatac
acctacatgagcttggacaggtttaacccaggagaatacagcctagagaaagttgccggg
tacttgagaatagaggataagtggatacttagcaggataaacacgcttattaagaaagtc
acggagctgatggattcatatgagctatatatagccgtaaggctgatcagagagttcttt
atagaagatcttagccactggtatataaggttgattaggccgcgtgtatgggtcgaggaa
aacaccggtgataaactggcagcttacgcggtgttatactatgtgttagatagggttgta
aggctattagcaccattcaccccattcatatccgagtatatttatcaggcgttaatgaag
cctgtttacggaaagcaatcagtacatcttcttgaattcccagagacagattcaagctta
atagatgaagggttagagaaggagatggatatattgaggaaaatatatgagacagctgga
gcagccaggatgaagcagggtataaagttccgtcagccagttaagaggctcatagtgtat
acagaccggaaggaaatagttgaagccgtatctagaaacatggagcttgtaaaagccatc
acgaattctaaggaagtgttggtcgaaccccccaggctcatgggtgaaatagttaggtat
aaggttgagccagtatacaagagcattggtccaaggtataagtccctcactaaacaagta
ttgagatacattgaggagaaccaagagagaatagcctttgacatacttaacaatggtaag
catgaggcagatgtaaacgggttgagaataattttaacaaaggatgatgtagtgataacg
ccctactacatcgaggggtatagtgtagaggatgccgagtggggcagtgttgcgattgac
acagtgttaagtgagggggagatagcggagggaatagccagagatctcgtcaggaggata
caggtgatgaggaaaatgcttaacctacaacttgatgcaagaatcaagacaaccataatg
accccacccgacaaaatgcaactcgttgagaaaatgagtagttatattatgaatgaaact
aggagcatagagttgaagatcatgccaggctataatggaagagactcattgaggggcttc
actcagtcatgggatataaatgatgaagaatatattatagggattgaggtagtatga

DBGET integrated database retrieval system