KEGG   Desulfurococcus amylolyticus 1221n: DKAM_1140Help
Entry
DKAM_1140         CDS       T00817                                 

Definition
(GenBank) ribulose bisophosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka00630  Glyoxylate and dicarboxylate metabolism
dka01100  Metabolic pathways
dka01110  Biosynthesis of secondary metabolites
dka01120  Microbial metabolism in diverse environments
dka01130  Biosynthesis of antibiotics
dka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dka00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DKAM_1140
Enzymes [BR:dka01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DKAM_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF697 LigA
Motif
Other DBs
NCBI-ProteinID: ACL11466
UniProt: B8D5T5
Position
1072426..1073772
Genome map
AA seq 448 aa AA seqDB search
MKLMSGKFEFETYHEYIDKNYTPDPSNDVIAVYRVKPAQGFTIEDAAGGVAAESSTGTWT
SLYNWYDVGRVRRLSGKAYYFKDLDDGSWIVKIAYPVELFEEGNIPGLLASIAGNIFGMK
RVEGLRLEDIYLPKKFLESFKGPSKGLNGVREIFGVKDRPIVGTVPKPKEGYSPEEVEKL
ALELLSGGLDYIKDDENLTSPSFCRFEARAKAIMKVIDKVEKETGERKVWFANITSDIRE
MEKRLRLVADYGNPYIMVDVVITGWSALTYIRDLAEEYGLAIHGHRAMHAAFTRNPYHGI
SMYVLAKLYRIIGIDQLHIGTAGAGKLEGGKLDVIRYAKILREIHFKPDPDDMYHLEQPM
HHIKPAMPVSSGGLHPGNLPPVIEALGTNLVLQIGGGVIGHPDGPRAGALAVRQALEAIM
NNIPLDEYAKTHRELARALEKWGFAKPI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttgatgagtgggaaattcgagtttgaaacataccacgagtacatagacaagaac
tatactcctgaccccagtaacgatgtaatagctgtatacagggttaagcctgcacaggga
ttcactattgaggacgctgcagggggcgtagctgctgagagtagcactggtacgtggacc
agcctttacaattggtacgatgtagggagagttagaaggctgagtggtaaagcatactac
ttcaaagaccttgacgatggatcatggattgtgaaaatagcatacccagtggagttattc
gaggaaggaaatataccgggcctgctggcatccatagctggaaacatatttggtatgaag
cgtgttgaaggattaagactcgaggacatatatctccccaagaaattcctcgagtcattt
aagggacccagtaagggattaaatggtgttagagagatattcggggtaaaggataggcct
atagtaggcacggtgccgaagcccaaggagggttactcaccggaggaagtggagaagctg
gctttagagttgctaagcggtggattagactacataaaagacgacgaaaacctgaccagc
ccaagcttctgtaggttcgaggccagagctaaggccattatgaaggtcattgataaagta
gagaaagagacaggtgagagaaaagtctggttcgccaatattacctccgatatacgtgaa
atggagaagaggctgaggctagtagcagactacggtaacccatacataatggttgatgtc
gtgatcaccgggtggagcgcactgacatatatcagggatctagcagaggagtatggacta
gcaatacatgggcacagagcaatgcatgcagccttcaccaggaatccataccacggcatc
tcaatgtacgtgctggctaaattatacaggatcataggaatagaccaactacacattggc
acagccggggcaggaaaactcgaaggcgggaagctagacgttataagatacgctaaaata
ctgagagagatacacttcaagccagacccagatgatatgtaccacctagagcaaccaatg
caccacatcaagccggcaatgcctgtctcatcaggtggtttacacccaggcaacctccca
ccagtaatagaggctctgggtacaaacctggtgctacaaataggtggtggggtaataggt
catccagacgggcctagagccggagcactggctgttagacaggcactggaggcaataatg
aataatattccactagacgagtacgctaagacacatagagagctggcaagagcactggag
aaatggggctttgcaaaacccatctag

DBGET integrated database retrieval system