KEGG   Desulfurococcus amylolyticus 1221n: DKAM_1174
Entry
DKAM_1174         CDS       T00817                                 

Definition
(GenBank) 50S ribosomal protein L2P
  KO
K02886  large subunit ribosomal protein L2
Organism
dka  Desulfurococcus amylolyticus 1221n
Pathway
dka03010  Ribosome
Brite
KEGG Orthology (KO) [BR:dka00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    DKAM_1174
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:dka03011]
    DKAM_1174
Ribosome [BR:dka03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    DKAM_1174
  Bacteria
    DKAM_1174
  Archaea
    DKAM_1174
SSDB
Motif
Pfam: Ribosomal_L2_C Ribosomal_L2
Other DBs
NCBI-ProteinID: ACL11500
UniProt: B8D5W9
Position
complement(1094502..1095221)
AA seq 239 aa
MGKRIIPQRRGKASPVFKTPDHIHVAPARYPLLDPSKTYKAVVEDLVHDPGRWVPLAQVK
LETGLVFYVPAVEGMYAGQIIEIGPGAKPVNGNILPVGMIPEGMQVVNIEKRPGDGGKFV
RASGTYAVIVGRAGGKTQVQLPSGRVIEVPNESRAMIGVIAGGGRLEKPLLKAGAAYYKW
SAKSRVWPKVRGVAMNAAFHPHGGGSHQHVGRPSTVARNTPPGRKVGHIAARRTGRRKG
NT seq 720 nt   +upstreamnt  +downstreamnt
atgggtaagaggattatacctcagagaaggggtaaggcttccccggtattcaagacacct
gatcacatacatgtagcaccagccagatacccgttgctagacccctctaaaacctataaa
gctgtagtagaggacttagtccatgaccccggtagatgggtgcctctggcccaggttaaa
ctggagacggggctagtattctacgttcccgctgtagagggaatgtatgctggtcaaata
atagagataggtcctggagccaagcccgtcaacggcaatatactcccggtaggcatgatc
cccgagggaatgcaggttgtaaatatagagaagaggcctggtgatggaggtaaatttgtc
cgagcaagtggtacatacgccgttattgttggcagagctggcggtaaaacacaggttcaa
ctaccgagtggtagagtaatcgaggtccccaacgagtccagagccatgatcggcgtgata
gctgggggcggtagattagagaagcccttattgaaagctggtgcagcatattataagtgg
agcgctaaaagtcgcgtgtggcctaaggttagaggcgtggcaatgaatgcagcgttccat
ccccatggtggtggtagccaccagcatgtgggtaggccgagcacagtggcacgtaatact
ccaccaggtagaaaggtagggcacatagctgctaggaggacgggtaggagaaagggctag

DBGET integrated database retrieval system