KEGG   Dokdonella koreensis: I596_1162Help
Entry
I596_1162         CDS       T04377                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase/Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dko  Dokdonella koreensis
Pathway
dko00071  Fatty acid degradation
dko00072  Synthesis and degradation of ketone bodies
dko00280  Valine, leucine and isoleucine degradation
dko00310  Lysine degradation
dko00362  Benzoate degradation
dko00380  Tryptophan metabolism
dko00620  Pyruvate metabolism
dko00630  Glyoxylate and dicarboxylate metabolism
dko00640  Propanoate metabolism
dko00650  Butanoate metabolism
dko00900  Terpenoid backbone biosynthesis
dko01100  Metabolic pathways
dko01110  Biosynthesis of secondary metabolites
dko01120  Microbial metabolism in diverse environments
dko01130  Biosynthesis of antibiotics
dko01200  Carbon metabolism
dko01212  Fatty acid metabolism
dko02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dko00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I596_1162
   00630 Glyoxylate and dicarboxylate metabolism
    I596_1162
   00640 Propanoate metabolism
    I596_1162
   00650 Butanoate metabolism
    I596_1162
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I596_1162
   00072 Synthesis and degradation of ketone bodies
    I596_1162
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I596_1162
   00310 Lysine degradation
    I596_1162
   00380 Tryptophan metabolism
    I596_1162
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I596_1162
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I596_1162
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I596_1162
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dko04147]
    I596_1162
Enzymes [BR:dko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I596_1162
Exosome [BR:dko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I596_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt DUF2999
Motif
Other DBs
NCBI-ProteinID: ANB17192
UniProt: A0A167GR05
Position
complement(1381108..1382280)
Genome map
AA seq 390 aa AA seqDB search
MSDVVIVGAKRTAIGSMLGQFTGVPTPTLGATAIRAALEQSGVAADQVSEVIMGCVLPAN
LGQAPARQAALAAGLPTSTGCTTINKVCGSGMKAIMLANDLIKAGSASVVVAGGMESMTN
APHMVNARPGLRYGDAKLVDHMAWDGLTNPYDGQSMGVFAEATAEKYGFTREQQDAYTIE
SVKRSQAAIASGAFAAEIVPVKVASRKGEIEVATDEQPGKSDIAKIPTLKGAFKKDGTVT
AASSSSISDGAAATVLMSADEASKRGVKPLARIVAHATHSQEPQWFTTAPVTAIENVLKK
AGWNVADVDLFEVNEAFAVVAMAPIKDLGIAHEKLNVNGGACALGHPIGASGARLVVTLL
HALQARGGKRGVAALCIGGGEATAIAIELA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatgtcgtcatcgtcggcgccaagcgcaccgccatcggttccatgctcggccag
ttcaccggcgtgccgacgccgaccctcggcgccaccgcgatccgcgctgcgctggagcaa
tcgggcgtcgccgccgaccaggtatcggaggtcatcatgggctgcgtgctgccggccaac
ctcggccaggcaccggcgcgccaggccgcgctggcggccggcctgcccacgtccaccggc
tgcacgacgatcaacaaggtctgcggctcgggcatgaaggcgatcatgctcgccaacgac
ctgatcaaggccggctcggccagcgtcgtcgtcgccggcggcatggaatcgatgaccaac
gcgccgcacatggtcaacgcgcgcccgggcctgcgctacggcgatgccaagctggtcgac
cacatggcctgggacggcctgaccaacccttacgacggccagtcgatgggcgtgttcgcc
gaggccaccgccgagaaatacggtttcacgcgcgagcaacaggacgcctacacgatcgag
tcggtcaagcgttcgcaggccgcgatcgcctccggcgcgttcgccgccgagatcgttccg
gtcaaggtcgcctcgcgcaagggcgagatcgaggtcgccaccgacgagcagccgggcaag
tccgacatcgccaagatcccgaccctcaaaggtgcgttcaagaaggacggcaccgtcacc
gcggccagttcctcgagcatctccgacggcgccgccgccaccgtgctgatgagcgcggac
gaggcgagcaagcgcggcgtgaagccgctcgcgcgcatcgtcgcgcatgccacgcactcg
caggagccgcagtggttcacgaccgcaccggtcaccgcgatcgagaacgtcctgaagaag
gccggctggaacgtcgccgacgtcgacctgttcgaagtcaacgaggcgttcgccgtggtc
gcgatggcaccgatcaaggatctgggcatcgcgcacgagaagctcaacgtcaacggcggc
gcctgtgcgctcggccacccgatcggcgcctccggcgcgcgcctcgtcgtgaccctgctg
cacgcgctgcaggcccgcggcggcaagcgtggtgtcgcggcgctgtgcatcggcggcggc
gaggcgaccgcgatcgcgatcgaactggcgtga

DBGET integrated database retrieval system