KEGG   Dokdonella koreensis: I596_2777Help
Entry
I596_2777         CDS       T04377                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dko  Dokdonella koreensis
Pathway
dko00970  Aminoacyl-tRNA biosynthesis
dko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dko00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I596_2777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dko03029]
    I596_2777
Enzymes [BR:dko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     I596_2777
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     I596_2777
Mitochondrial biogenesis [BR:dko03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    I596_2777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ANB18772
UniProt: A0A161HRJ4
Position
complement(3170533..3171957)
Genome map
AA seq 474 aa AA seqDB search
MSHPLDHGVRACVQALAEGRLAAADLADEARRRATAAAALNAFISPDPRTPAPVAGPLAG
IPFAQKDNFCTQGLRTTCASRMLEGFVPPYESAVGERLRAAGAVSIGKTNLDEFAMGSSN
ENSHYGVVRNPWDATRVPGGSSGGSAAAVAAGIVPFATGSDTGGSVRQPAAFCGVTGLKP
TYGRVSRWGLVAYASSLDCPGVLARSAEDCAYVLGAIAGHDVRDATSADRPAEDYAGALD
APLAGLRIGTARPYFGAGVEDGVAATVRAALAEYERLGARLVEIDLPHAHLAIPAYYVIA
PAEASSNLSRYDGVRFGHRCANPRSLEDLYTRSRAEGFGAEVRRRILIGTFALSAGYYDA
YYLRAQKVRRLIAGDFDAAFAAVDLIAGPTAPTVAFGLGEKHADPLAMIAADINTVAVNL
AGLPAVSIPAGFHAGLPVGLQLIAPAFAEARLLAAAHRFQQATDWHRQRPGGKP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagccatccgctcgaccacggtgtgcgtgcctgcgtgcaggcgctggccgaaggccgc
ctcgcggcggcggacctcgcggacgaggcgcgccgccgcgccaccgcggccgccgcgctc
aacgcgttcatcagcccggacccacgcacgccggcgccggtggccggtccgctggctggc
atcccgttcgcgcagaaggacaacttctgcacgcagggcctgcgcaccacctgcgcctcg
cgcatgctcgagggcttcgtgccgccgtacgaatcggcggtcggcgagcgcctgcgcgcg
gccggcgcggtctcgatcggcaagaccaacctcgacgagttcgcgatgggctcgtcgaac
gagaacagccactacggcgtggtgcgcaacccctgggacgccacgcgcgtgccgggcggc
tcgtccggcggctcggcggcggcggtcgccgccggcatcgtgccgttcgccaccggcagc
gacaccggcggctcggtgcgccagccggccgcgttctgcggcgtgaccggcctgaaaccg
acctacggccgcgtctcgcgctggggcctggtggcctatgcctccagcctggactgcccc
ggcgtgctggcgcgcagcgccgaggactgcgcgtacgtgctcggcgcgatcgccggccac
gatgtgcgcgacgccaccagcgccgaccgtccggccgaggactacgccggcgcgctcgac
gcaccgctggccggcctgcgcatcggcaccgcccggccgtacttcggcgcgggcgtcgag
gacggcgtggcggcgaccgtgcgcgcggcgctggccgagtacgagcggctcggcgcgcgg
ctggtcgagatcgacctgccgcatgcgcacctggcgatcccggcctactacgtgatcgcg
ccggccgaggcgtccagcaacctgtcgcgctacgacggcgtgcgcttcggccatcgctgc
gcgaatccccgcagcctggaggacctctacacgcgcagccgcgccgagggcttcggcgcc
gaggtgcgccggcgcatcctgatcggcacgttcgcgctgtcggccggctactacgatgcc
tactacctgcgcgcgcagaaggtacgccggctgatcgccggcgatttcgacgcggcgttc
gcggcggtcgacctgatcgccgggccgacggcaccgaccgtggcgttcggcctcggcgag
aagcacgccgatccgctggcgatgatcgccgccgacatcaacacggtcgcggtcaacctg
gccggcctgccggcggtctcgatcccggccggcttccacgccggcctgccggtgggcctg
cagctgatcgcgccggcgttcgccgaggcgcgcctgctggccgccgcccaccgcttccag
caggcgaccgactggcaccggcagcgcccgggaggcaagccatga

DBGET integrated database retrieval system