KEGG   Dokdonella koreensis: I596_3024Help
Entry
I596_3024         CDS       T04377                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
dko  Dokdonella koreensis
Brite
Enzymes [BR:dko01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     I596_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ANB19016
UniProt: A0A167H5J4
Position
3472493..3473071
Genome map
AA seq 192 aa AA seqDB search
MAIELPPLPWARDALAPHISAETIDYHYGKHHQTYVTNLNNQIKGTEFEELSLEDIIRKS
SGGMFNNAAQIWNHTFYWNCLSPTGGGEPGGVLADKINQAFGDFAKFKDEFTKTSVGTFG
SGWGWLVQRPDGSLALASTSNAGTPLTGTDRALLTCDVWEHAYYIDYRNARPKYVEAFWN
LVNWDFVASQLA
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgaacttcccccgcttccctgggcccgcgacgcgctggcgccgcacatctcg
gcggaaacgatcgactaccactacggcaagcaccaccagacctacgtcaccaacctcaac
aaccagatcaagggcaccgagttcgaggagctctcgctggaggacatcatccgcaagtcc
agcggcggcatgttcaacaacgccgcgcagatctggaaccacacgttctactggaactgc
ctgtcgcccaccggcggcggcgagcccggcggcgtcctggccgacaagatcaaccaggcc
ttcggcgacttcgccaagttcaaggacgagttcaccaagacctcggtcggcacgttcggc
tcgggctggggctggctggtgcagcgcccggacggcagcctggccctggccagcacgtcc
aacgccggcacgccgctgaccggcaccgatcgcgcgctgctgacctgcgacgtctgggag
cacgcctactacatcgactaccgcaacgcgcggccgaagtacgtcgaggcgttctggaac
ctcgtcaactgggatttcgtcgccagccagctggcctga

DBGET integrated database retrieval system