KEGG   Desulfofundulus kuznetsovii: Desku_0043Help
Entry
Desku_0043        CDS       T01499                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00450  Selenocompound metabolism
dku00970  Aminoacyl-tRNA biosynthesis
dku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Desku_0043
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Desku_0043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dku01007]
    Desku_0043
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dku03016]
    Desku_0043
Enzymes [BR:dku01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Desku_0043
Amino acid related enzymes [BR:dku01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Desku_0043
Transfer RNA biogenesis [BR:dku03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Desku_0043
 Prokaryotic type
   Other AARSs
    Desku_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f DUF1272 DALR_1
Motif
Other DBs
NCBI-ProteinID: AEG13693
UniProt: F6CLL7
Position
46626..48188
Genome map
AA seq 520 aa AA seqDB search
MRKTFYITTPIYYPSDNLHIGHAYTTVAADAMARFKRLTGYDVWFLTGSDEHGQKIERTA
RAKGMTPREYVDRIVAGFKHLWKKLDISYDDFIRTTEERHKRVVQAIFQKLYDQGDIYKA
SYEGWYCTPCETFWTESRLEEGNCPDCGRPVELVREESYFFRLSRYADRLLQYIEENPHF
IQPVSRRNEMISFIKSGLEDLCVSRTTFDWGIPVPFDPKHVIYVWVDALTNYISALGYGS
GDDSLFRKFWPADVHLVGKDIVRFHSIIWPIILMAAGIELPRQVVGHGWLLLESGKMSKS
RGNVVDPLVLIDKYGVDAIRYYLLREMPFGADAYYSEESLVQRINIDLANDLGNLVSRTL
GMIEKYSGGVLPQPGPAEGVDRELIELAEQTPAVVEELIDRRELSSALGAIWKLVNRANK
YVDETEPWVLNRDPARRERLNTVLYNLAESMRFIGVLITAFMPNTPGRIWSQLGIADQPG
LHTWESLSWGCLPAGIKVRRGEALFPRIDLKTLEKDRGLA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcaaaacgttttatatcaccacacccatttactatcccagcgacaacctgcatatc
ggccatgcctacaccaccgtggccgccgatgccatggcccggttcaaacgcctcaccggc
tacgacgtctggtttttaaccggctccgacgagcacggccagaaaattgaacgcaccgcc
cgggcaaaaggtatgactccccgggaatatgtggacaggattgtggccgggttcaagcac
ctgtggaaaaaactggacatcagctatgacgacttcatccgcaccaccgaggaaaggcac
aagcgggtagtccaggccattttccagaagctttacgaccagggggacatttacaaggcc
agctacgagggctggtactgcactccctgcgaaaccttctggacggaaagccggctggag
gagggcaactgcccggactgcggccgtccggtggagctggtgcgggaggagagttacttc
ttccgcctgtccagatatgccgaccggttgctgcagtacatcgaggaaaatccccatttc
atccagcccgtctcccggcgcaacgaaatgatcagctttatcaaaagcggtctggaagat
ttgtgcgtttcccgcactaccttcgactggggcatcccggtgcctttcgatcccaagcac
gtaatctacgtctgggtggacgccctgaccaactacatttcagccctgggctacggcagc
ggggacgacagccttttccgcaagttctggccggccgacgtccacctggtgggaaaggac
atcgtacgcttccacagcatcatctggcccattatccttatggccgccggcattgagctg
ccccggcaggtggtgggacacgggtggctcctgctggagagcgggaagatgagcaaatcc
aggggcaacgtggtggatcccctggtcctgattgacaagtacggggtggatgccatccgc
tactacctgctccgggagatgccctttggggccgacgcctattactccgaggaatccctg
gtgcagcgcattaacatcgacctggccaacgacctgggcaacctggtcagccgcaccctg
ggtatgattgaaaagtattccggcggcgtgctgccacagcccgggccggcggaaggcgtg
gaccgggaactaattgaactggccgaacaaacccctgcggtggtggaggagctgattgac
cgccgggagctgtccagcgccctgggcgccatctggaaactggtcaaccgggccaataag
tacgtcgacgaaacggagccctgggttttgaaccgggatcccgcccgccgggaacgcctg
aacaccgtgctctacaacctggcggaaagcatgcgctttatcggcgtgttgatcaccgcc
tttatgcccaatactcccggccggatctggtcccagctgggcattgccgaccaacccggg
ctccatacctgggagtccttgagctgggggtgcctgccggcgggaataaaggtgcggcgg
ggcgaagccctcttcccgcgcattgatctgaagaccctggaaaaggacagggggttagca
tga

DBGET integrated database retrieval system