KEGG   Desulfofundulus kuznetsovii: Desku_0367Help
Entry
Desku_0367        CDS       T01499                                 

Definition
(GenBank) Glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00471  D-Glutamine and D-glutamate metabolism
dku01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Desku_0367
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dku01011]
    Desku_0367
Enzymes [BR:dku01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     Desku_0367
Peptidoglycan biosynthesis and degradation proteins [BR:dku01011]
 Precursor biosynthesis
  Racemase
   Desku_0367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AEG13995
UniProt: F6CP58
Position
386055..386861
Genome map
AA seq 268 aa AA seqDB search
MSDPRPIGLFDSGVGGLTVSRQIFRLMPGESTVYFGDNAHVPYGPRKPEELIGFAESILT
FLVSCGVKYVIFACNTNSSISLPVVRERYAVPMIGLIEPGVREAVRVSTGGRIGVIATEA
TIKSGAYQRALKALNPELAVFGQAAPRLVPLVEAGRAGTREALEAVSEYVQPLKQAGMDT
LILGCTHYPFLEAEFREVLGPEVKLVDPAEATIMAAREEMSRLGLLNNPGGGPVQHRYFV
SGDPRVFQEAARHFLGEDIPSVQQVKLD
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttgagcgatcccagaccaattggtctttttgattcgggagtagggggactcaccgtttcc
cggcagatttttcgcctgatgcccggggaatccaccgtttattttggagacaacgcccat
gtaccctacggacctcgcaaaccggaagaactgattgggtttgccgagagcatcctcacc
ttcctggtgtcctgcggggtgaaatacgtgatctttgcctgcaacaccaactcttccatt
tctctgcccgtggtcagggaacgctatgcggtacccatgatcggcctgatcgagccgggg
gtaagggaagcggtacgggtgagtaccgggggacgcattggggtcattgccacggaagcc
accatcaaaagcggcgcttaccagcgggcgttgaaggctttaaatccggaactggcggtg
ttcggccaggctgccccccgcctggtacccctggtggaggcgggccgggccggtaccagg
gaggccctggaggcggtgtccgagtatgtgcagccattaaaacaggccggcatggacacc
ctcattttaggttgcactcactatccgtttctggaagccgaattccgggaggtgctcggc
ccggaggtaaaactggtcgatcccgcggaagccaccatcatggccgcccgggaggagatg
tcccggctggggttgttaaacaatcccggcggagggccggtgcagcaccgttattttgtc
agcggtgatccccgggtgtttcaggaggcggcccgccattttttaggggaggatattcca
tccgtccagcaggtgaaacttgactga

DBGET integrated database retrieval system