KEGG   Desulfofundulus kuznetsovii: Desku_0375Help
Entry
Desku_0375        CDS       T01499                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dku  Desulfofundulus kuznetsovii
Brite
KEGG Orthology (KO) [BR:dku00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Desku_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEG14003
UniProt: F6CP66
Position
392329..393372
Genome map
AA seq 347 aa AA seqDB search
MLKKGEYRVPDPHLLLIFVVIVLALTFDFINGFHDTANAIATSISTKALRPRTAIVLASV
MNFVGAMTFTGVAKTIGGKIADPLSLSNGLVIVLAALLAASAWNLITWYYGLPSSSSHAL
IGSLTGAVIAAAGFSAVNFHGFINILKALVFSPILAVGVGFTIMTLIKLVFRNAVPHRIN
RRFRMLQVFTAAFQAFSHGTNDAQKTMGIITFALVAGGFQSSLHVPFWVKLSAALAMALG
TSVGGWRIIKTVGTRIIKLEPGSGFSADLSSALVILGATLLKLPVSTTHVISSSVIGVGT
ARRFSTVKWGTAQKIVLAWVVTLPVTAVLAGLSYGLCAGIGRLAAVF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaagaaaggggaataccgggtgcctgaccctcacctcttgctgatcttcgtggta
atcgtcctggcactgacctttgactttatcaacggttttcatgatacggccaacgccatc
gccacttccatttccaccaaggctctgaggccccggacggccatcgtcctggcttcggtg
atgaattttgtgggggctatgaccttcacgggcgtggccaagaccatcggcggcaaaatt
gccgatcctttaagcctgagcaacgggctggttattgtgctggcagctcttctggcggcc
agtgcctggaacctgatcacctggtactacggcctccccagcagttcctcccacgccctg
attggttctttaaccggggctgtgatcgccgccgccggcttctcagcggttaatttccac
ggtttcatcaatatcctgaaagccctggttttctccccgatcctggccgtgggcgtgggt
tttaccattatgaccttaatcaagctagtttttcgtaacgccgttcctcaccggattaac
cggcgcttccgcatgctccaggtctttaccgccgccttccaggccttttcccacggcacc
aacgatgcccagaaaaccatgggtatcattacctttgccctggtagccggtggttttcaa
agttcacttcacgttccattttgggtcaagctttctgccgccctggccatggcgctgggc
acctcggtgggcggctggaggatcatcaaaaccgtcggcacgcgcatcatcaagctggag
cccggcagcgggttttccgccgacttgagttcggccctggtgatcctgggagctactttg
ctcaagctcccggtgagcaccacccacgtgatttcctcttcggttatcggcgtgggtacg
gccaggcgtttttccacggtcaagtgggggacggcgcaaaagatcgtcctggcctgggtg
gtgacgctgccagtgactgccgttctggcggggttgtcctacgggctgtgcgccggtatc
ggccggctggcggcagtgttttaa

DBGET integrated database retrieval system