KEGG   Desulfofundulus kuznetsovii: Desku_1211Help
Entry
Desku_1211        CDS       T01499                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dku  Desulfofundulus kuznetsovii
Pathway
dku00071  Fatty acid degradation
dku00072  Synthesis and degradation of ketone bodies
dku00280  Valine, leucine and isoleucine degradation
dku00310  Lysine degradation
dku00362  Benzoate degradation
dku00620  Pyruvate metabolism
dku00630  Glyoxylate and dicarboxylate metabolism
dku00640  Propanoate metabolism
dku00650  Butanoate metabolism
dku00900  Terpenoid backbone biosynthesis
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
dku01200  Carbon metabolism
dku01212  Fatty acid metabolism
dku02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desku_1211
   00630 Glyoxylate and dicarboxylate metabolism
    Desku_1211
   00640 Propanoate metabolism
    Desku_1211
   00650 Butanoate metabolism
    Desku_1211
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desku_1211
   00072 Synthesis and degradation of ketone bodies
    Desku_1211
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desku_1211
   00310 Lysine degradation
    Desku_1211
   00380 Tryptophan metabolism
    Desku_1211
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desku_1211
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desku_1211
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desku_1211
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dku04147]
    Desku_1211
Enzymes [BR:dku01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desku_1211
Exosome [BR:dku04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desku_1211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: AEG14794
UniProt: F6CJH4
Position
complement(1227845..1229026)
Genome map
AA seq 393 aa AA seqDB search
MRETVIVSAARTPFGKLGGVLAPLTAVQLGGMVIKEAIQRAGINGDQVENVIMGQVLQGG
CGQIPSRQATRLAGLPWEVPSETINKVCASSLRAVTLGDQIIRAGDADIIVAGGMESMSN
APYFVHARWGLRMGDTRFVDLMVHDGLWCAFYNRHMAIHGGEVAREYGISREEQDEWALR
SHRLAIAAMDGGRLKEEIVPVAVPQKKGDPKVVDTDEAPRRDTSLEALRRLPPVFDPNNT
VTAGNAPGVNDGAGALVLMSREKAHELGIKPLATILGHASVSQDAKYIATVPGLSINKLL
AKKGLPVDAIDLFEVNEAFAAVVLVSVKIANLPKDKINVNGGAVAFGHPIGASGARILMT
LIYELRRRGGGLGIAAICSGAAQGDALLVRVDD
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggaaacggtaatcgtcagtgcagccagaacgccctttggaaagctgggcggggtt
ctggcccctctcactgccgtccagctggggggtatggtgattaaagaagccatccagcgg
gcgggcatcaacggggaccaggtggaaaacgtgatcatggggcaggtgctgcagggcggc
tgcggccagattccctcccgccaggccacccggctggcggggttgccctgggaggtgccc
tcggaaaccataaacaaggtctgtgcctccagcctgcgggcggtaaccctgggcgaccag
atcatccgggccggcgacgccgacatcattgttgccggcggcatggaaagcatgagcaac
gcgccctactttgtgcacgcccgctggggcctgcgcatgggtgacaccaggtttgtcgac
ctgatggtccacgacggcctgtggtgtgccttttacaaccggcacatggccatccacggc
ggcgaagtggccagagaatacggcatctcccgggaagaacaggacgaatgggccctgcgc
agccaccggctggccatcgcggccatggacggcgggcggctgaaggaagaaattgtgccc
gtggccgtaccccagaaaaagggcgacccgaaagtggtggacacggacgaagcgccccgg
cgggataccagcctggaggccctgcgccgcctgccgccggttttcgaccccaacaacacg
gttacggcgggcaatgccccgggggtcaacgacggggcgggggctctggtgctgatgtcc
cgggaaaaagcacacgagctgggcataaaacccctggccaccatactggggcatgcctcg
gtttcccaggatgccaaatacattgccaccgtaccgggattgtccatcaacaaactgctg
gccaaaaagggactcccggtggacgccattgacctttttgaagtgaacgaagcctttgcc
gccgtggtcctggtcagtgtaaagattgccaatttaccgaaagacaaaataaatgtgaac
ggcggcgcggtggccttcggccatcccattggcgccagcggcgcccgcatcctgatgaca
ctcatctatgaacttcgccggcgtggcggcggtttgggcattgcggccatctgcagcggc
gccgcccagggcgatgccctgctggtgcgggtagatgactag

DBGET integrated database retrieval system