KEGG   Desulfotomaculum kuznetsovii: Desku_1391Help
Entry
Desku_1391        CDS       T01499                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
dku  Desulfotomaculum kuznetsovii
Pathway
dku00010  Glycolysis / Gluconeogenesis
dku00030  Pentose phosphate pathway
dku00051  Fructose and mannose metabolism
dku00052  Galactose metabolism
dku00680  Methane metabolism
dku01100  Metabolic pathways
dku01110  Biosynthesis of secondary metabolites
dku01120  Microbial metabolism in diverse environments
dku01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dku00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desku_1391
   00030 Pentose phosphate pathway
    Desku_1391
   00051 Fructose and mannose metabolism
    Desku_1391
   00052 Galactose metabolism
    Desku_1391
  Energy metabolism
   00680 Methane metabolism
    Desku_1391
Enzymes [BR:dku01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desku_1391
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Desku_1391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Arc
Motif
Other DBs
NCBI-ProteinID: AEG14974
UniProt: F6CPW5
Position
complement(1411157..1412257)
Genome map
AA seq 366 aa AA seqDB search
MAAPTKIKRIGVLTGGGDAPGLNAVIRAVVKVAIREYGLSVIGFLNGFGGLIKNQARELT
EKDVVGILPRGGTILGTTNRDNPFHYPVVKGGKKVFVDVSDRIFENISIHGVDALIVIGG
DGSLAIAKELYAKGLAVVGVPKTIDNDLLATDQTFGFDTALTTATEALDKLHTTAESHHR
VMVLEVMGRYAGWIALAAGVAGGADVILIPEIPYRIEKVIDMINQREVQGKKFSIIVVAE
GAKPVDGELVVQKRVEDSFDPIRLGGIGHVVAQQVEEATGKETRVTILGHLQRGGSPTAF
DRILATRYGTGAVRLVVEGRFGHMVCLRGTSIDAVPLTEATGQIRAVPLESDLLLSARQL
GICLGD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggctgctccgactaaaattaaacgcattggtgtattaaccggcggaggcgacgctccc
ggactaaacgccgtcatcagggcggtggtaaaagtagctatcagggaatatggactttcg
gtaattggctttttaaacggttttgggggattgattaagaaccaggcccgggagcttacg
gaaaaggatgtagtgggtatcctgccccggggcggaactattctcggtaccaccaaccgt
gataatccctttcattatccagtggttaagggcgggaaaaaggtttttgtagacgtaagc
gatcgtatttttgaaaatatcagtatccacggggttgatgccctgatcgttatcggtgga
gatggcagcctggccattgctaaagagctgtacgctaaaggattggctgtggttggagtt
cctaagaccattgacaacgatttactggccacggatcaaactttcggttttgacactgcc
ctcaccaccgccaccgaagctctggacaagctacacactacggcggaatcccaccaccgg
gttatggttctggaggtaatggggcgttacgccggttggatagccctggctgccggggtg
gccggtggggctgacgtgatcttgattcctgaaattccctatcgcattgagaaggtcatc
gatatgatcaaccagcgggaagtacagggtaaaaagttcagcatcatcgtggtggccgaa
ggggctaaaccagtagacggagaattagtggttcaaaaaagggtggaggatagcttcgat
cccatccgtttgggtggcataggccatgtggtggctcaacaggtggaggaagccaccgga
aaagaaaccagggttactatactgggacacctgcaaagggggggttcccctacagccttt
gaccgcattctggctacacgctacggcacgggggcagtccggttggttgtggaagggcgt
ttcggacacatggtctgcctccggggcactagcattgacgccgtacccctcacggaagct
acagggcaaatccgcgccgtacccctagaaagcgatctgctgctctcggcaaggcaactg
gggatttgtctgggagattaa

DBGET integrated database retrieval system